KEGG   Methylomicrobium buryatense: EQU24_08720
Entry
EQU24_08720       CDS       T05995                                 

Definition
(GenBank) DUF1295 domain-containing protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mbur  Methylomicrobium buryatense
Pathway
mbur00100  Steroid biosynthesis
mbur01100  Metabolic pathways
mbur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    EQU24_08720
Enzymes [BR:mbur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     EQU24_08720
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: QCW82313
UniProt: A0A4P9UP52
Position
1932029..1933312
AA seq 427 aa
MSEQESRDNAAADAVRQKYGFGFSWLVLMIALPPLVYYLWICVTYYQGELIFTSDAEAWR
RFWSHVSPPTWQAAGLYAAWFLGQAALQVWAPGPTVQGMKLPDGSRLDYRMNGIFSFLFT
LAVVFGLVTMGWLDATILYDQLGPLLTVVNIFTFVFAGFLYFWGLNGKQWERPTGRPFYD
YFMGTALNPRIGSLDLKLFCEARPGMIFWLLMNLSMAAKQYELHGTVTVPMLLVVGFQSF
YLIDYFIHEEAVLTTWDIKHEKFGWMLCWGDLVWLPFTYTLQAQYLVHHTHDLPVWGIIA
IVALNLAGYTIFRGANIQKHHFRRDPNRIVWGKPAKYIKTKQGSLLLTSGWWGIARHMNY
FGDLMIALSWCLPAAFGSPIPYFHIVYFTILLLHREKRDDAMCLAKYGEDWLQYRKKVPW
RIVPKIY
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagtgaacaagaatcgagagacaatgcggccgcggatgcggttcgtcagaaatacggt
ttcggcttttcctggcttgtgctcatgatagcgttgccgccactggtctattatttgtgg
atttgcgtcacttattaccaaggcgagctgatcttcactagcgacgcggaggcttggcgg
cggttttggtctcatgtttcgccgccgacctggcaagccgcaggcctttacgcggcttgg
tttttaggtcaggccgcgttgcaggtttgggcgcctggtccgaccgttcaaggcatgaaa
ttgcctgacggcagtcggctcgattatcggatgaatggaatattttctttcctttttacc
ctggccgtggtgttcggtttggtaacgatggggtggttggacgctaccattttgtatgac
caactcggcccattgcttactgtagtgaatatttttacctttgtttttgcgggttttctc
tatttttggggcttaaacgggaagcaatgggagcggccgaccggacgtcctttttatgat
tatttcatgggaacggcgcttaacccacggattggatctcttgatctcaagctgttttgc
gaagcccgccccggcatgattttttggttactgatgaatctttcgatggcggccaaacag
tatgaattgcacggcacggtgactgtcccgatgttactggtggtggggtttcaaagtttt
tatttgatcgattactttattcatgaagaagccgtcctgacgacttgggatatcaagcat
gagaagtttggctggatgctttgttggggcgacttggtgtggctgccttttacctatacc
ttacaggctcagtatttggtccatcatacccatgacctgcccgtatggggcattattgct
attgtggctttgaatttggccggttatacaatttttcggggcgccaatatccaaaagcat
cattttcggcgcgatccaaaccggatcgtgtgggggaagccggcaaaatatatcaaaacc
aagcaaggttcattattactgacttccggttggtggggcattgctcgtcacatgaattac
ttcggcgatttaatgattgcactctcgtggtgtttgcccgctgctttcggtagccccata
ccttatttccatatcgtatatttcaccattttgcttctgcatagagaaaagcgcgatgat
gcgatgtgcttggcgaagtacggcgaagattggttgcaataccggaaaaaggtgccttgg
cgtatcgtgccaaaaatttactaa

DBGET integrated database retrieval system