KEGG   Mycoplasma bovis PG45: MBOVPG45_0479Help
Entry
MBOVPG45_0479     CDS       T01366                                 

Definition
(GenBank) conserved hypothetical protein (ICEB-1 encoded)
Organism
mbv  Mycoplasma bovis PG45
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0236 Nucleoporin_FG2
Motif
Other DBs
NCBI-ProteinID: ADR25239
Position
complement(550282..551514)
Genome map
AA seq 410 aa AA seqDB search
MNEFDIDIFDEVLNTTKSLYAAKAKELNDKELYFRTVLRKSLYPDWRIFRKTSRVWITLG
GIFTLNITMYETIDTNGKRKRFTYYHDEKLKQISKFKYDLDVIKLALKFYFEGNKIPDSL
KRIFPSKQLINYYLKAFNLKEKIEKKNDEILANIESNLQKTNSKLMLEMDDFYIFHKSER
IRKMRVRQVIMHTVNGSKLSNIINMFFTKNIDEATTKFNDMQFIKTTVSKQLNKFKSNKE
IIVNGDGARWIKHLANELNASYSLDLFHIKKAINDTFGANKFASKENKIYFKNNINYCLN
KPWKNAFSDAVFTKNELMFHTLYNEFFAYSSVINIPKVIHQNVQNFYKFIKNNSLTVFKN
NENDSSYTEHFVYNSFKKHIKKDQSLYCFELIKLRVIYKNIAKNQATLFY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattcgatattgatatttttgatgaagttttaaacactactaaaagtctatat
gcagctaaagctaaagagttaaatgataaagaactttactttagaacagtactaagaaaa
agtctttatcctgactgaagaatttttagaaaaactagtagagtctgaattaccttaggt
ggtatttttactctcaatattacaatgtatgaaactattgatactaacggaaagcgtaag
cgttttacatattatcacgatgaaaaattaaagcaaatatctaagtttaagtatgaccta
gatgttattaaattagcacttaaattttattttgaaggaaacaaaattcctgatagttta
aaaagaattttccctagtaagcaactaataaattattatcttaaagcatttaatcttaaa
gaaaaaatagagaagaagaatgatgaaatattagcaaatattgaatctaatttacaaaaa
actaatagcaaattaatgttagaaatggatgacttttatatctttcataaaagcgaaaga
attaggaaaatgagagtaagacaggtaataatgcacactgttaatggaagcaaattatca
aacataatcaatatgttttttactaaaaatattgatgaagcaactacaaaatttaatgat
atgcagtttatcaaaactacagtaagtaagcaattaaataagtttaaaagcaacaaggaa
attattgtaaatggcgatggcgctagatgaataaagcatctagcaaatgaattaaatgct
tcatattccttagatctttttcatatcaaaaaagcaattaatgacacatttggtgcaaat
aaatttgcttctaaagagaataaaatatactttaaaaacaatataaattattgcttaaat
aagccctgaaaaaatgctttttccgatgcagtttttactaaaaatgaattaatgtttcac
acactttataatgaattttttgcttactctagtgttataaacataccgaaagttattcat
caaaatgtacaaaatttttataaattcatcaaaaataactccctaactgtctttaaaaat
aatgaaaatgatagttcatatactgagcattttgtctacaattcattcaaaaaacacatt
aaaaaagatcaaagtttatactgttttgagcttataaaactaagagtaatttacaaaaat
attgcaaaaaatcaagccacacttttttattaa

DBGET integrated database retrieval system