KEGG   Mycoplasma bovis PG45: MBOVPG45_0483Help
Entry
MBOVPG45_0483     CDS       T01366                                 

Definition
(GenBank) TraE family protein (ICEB-1 encoded)
Organism
mbv  Mycoplasma bovis PG45
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853 FtsK_SpoIIIE PrgI
Motif
Other DBs
NCBI-ProteinID: ADR25075
Position
complement(557828..560653)
Genome map
AA seq 941 aa AA seqDB search
MLQPKNLKKTQNYFWKSFSWLDFLVVCIVIILSVTIGYTVFPPNYPKKWSLILSILLILA
FSTILIKSNKYDCRLYILFFRMIKYLFSVKKYNKNQYSPKLLVPYKAIIENKFIKTKQLK
AGSKYIAILRFQGKSPWNEDSEDREVFLNKFTELLDTSDYHLTFIRKKELADYRQNFECL
KKNKKRKLATLAANKSAKSVVKSYKTYYEYVNNDLELLDTELLVDTYYIAVYAKDLLELK
KMVLNTIANFNAMDIESELIEGLELLKFLASVSLKTLNEEEAIKYLEYQMNNNQRDSFNA
KDDHIFETLTFREKVKEFFKFLKSNFKKKPISKEIKTNKPKTLDELLSSDTVFKRNYFIK
DGKYYSIHTISELPLNLSEGWAISLFDNDATIVWNMGIFNEASQAALLDKSGKRMSDNKT
LIKSNYFRASSSLQIEALEYLQSQLQENKNLLMNSSLMIINEANSLKELRKAESKVLTTA
KRAKLNINTVPFKQFEALAQACLITSDNLHEAIPMSSYNISHGWAFENETNNDNNAFILG
STASTGEPIIFDQFYKKSARRVNYNMFTVGSSGKGKSTDVKKAILGHLAHNNKVYIIDPQ
NEYSKLGNNFGATLIDLGLGHKTIINPLHVQIQLFNDDEEISTKLIINKHLEWLETYFKL
INADWNQDYIVFLMSMVRSLYEKIGLYNLKNINELKEFNYPIISDLIKHLQEYKWKDEFE
KQRKKIVLANIIDRLSFDYENNGKYEYIYNGQTNIDLSNDFIIFNTQKLFNTSKDSGQVG
LFVLLSFIQNKIFNNAIEDKEAKTVLVIDELHMYIDPSNTATLDFVYTMTKTVRKFNAGM
ILCTQNPSDFLGSSNITKKAEAILQNCQYAKFFGLKQKDLEAVMDMFKSTGGLNNTHQRF
LADSDVGNLIFSLHMYSKIKGSIYYNEYEKQLFFDKGIIGQ
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgctacagcctaaaaatttaaaaaagactcaaaactacttttgaaagtcctttagctga
ctagactttctggtagtgtgcattgtgattattcttagtgtaacaataggttatacagta
tttccccctaattatcctaagaagtgaagtttaattctttctatattactaatactagca
ttttcaacaattttaattaagtcgaataaatatgactgtcgactatacattctatttttt
agaatgattaaatatctttttagtgtcaaaaaatacaataagaatcaatatagccctaaa
ttattagttccttataaagctattattgagaataagtttataaaaactaaacaattaaaa
gcaggttcaaaatatattgctattttacgtttccaaggtaaaagtccatgaaatgaagat
tctgaagatagagaagtatttttaaataagtttactgaactattagatacaagtgactat
catttaacttttataagaaaaaaagagttagctgactacaggcaaaattttgaatgctta
aagaaaaataaaaaaagaaaattagctacattagctgctaataaaagtgcaaaaagtgta
gttaaaagttataaaacatattatgaatatgtaaataacgacttagagttactagatact
gaattattagtggatacatactatatagcagtatatgctaaagatcttttagaacttaaa
aaaatggtgcttaatactattgctaactttaatgcaatggatattgaaagcgaattaata
gaaggcttagaattgctaaagtttttagcgtctgtaagccttaagactttaaatgaagaa
gaagcaattaaatatttagaatatcaaatgaataataaccaacgagattcatttaatgct
aaagatgatcatatttttgaaacattaacttttagagaaaaagttaaagagtttttcaag
tttttaaaaagcaattttaaaaagaagcctataagtaaagaaattaaaactaataagcct
aaaacattagatgaattgctttcatctgatacagtgtttaagcgtaattactttattaaa
gatggcaaatactattcaatacatacaataagcgaattaccgcttaatttaagcgaaggc
tgggctataagcttatttgacaatgacgctactattgtctgaaatatgggcatattcaat
gaagcgtcgcaagctgctttattggataagtctggcaaaaggatgagtgataataaaaca
ttaattaagtcaaattactttagggcttcatctagtttacaaattgaagccttagaatat
ttacagagtcaattacaagagaataaaaacttattaatgaatagttcattaatgataatt
aatgaagctaacagcttaaaagaattaagaaaagctgaaagtaaagttttaactactgct
aaaagggctaagttaaacattaacactgtaccttttaaacaatttgaagccttagcgcaa
gcgtgcttaattactagtgataacttacacgaagcaataccaatgagtagttataacatt
agccatggctgggcatttgagaatgaaactaataatgataataatgcatttatcctaggc
agtaccgcttctactggagaacctataatttttgaccaattttataaaaagagtgcaaga
agagttaattacaatatgtttactgtaggttcatcaggtaaaggtaagtcgactgatgtt
aaaaaggctattttaggccatttagcacacaataataaggtatatattatcgatccacaa
aatgagtattcaaaattaggcaataattttggcgctactttaattgatttaggcctaggg
cataaaacaataattaatccattacatgtacaaatacagctttttaatgatgatgaagaa
attagcactaagttaataattaataaacatttagaatggttagaaacatactttaagtta
attaatgctgactggaatcaagactacattgtatttttaatgtcaatggtaagaagccta
tatgaaaagatagggctttataacttaaaaaacattaatgaattaaaagagtttaattat
ccaataattagtgacttaattaagcatttacaagagtacaaatgaaaagatgaatttgaa
aaacagagaaagaaaattgttttagctaatattattgataggctttcatttgactatgaa
aataacggtaaatatgaatatatttacaacgggcaaacaaatattgatctttctaatgac
tttatcattttcaatacgcaaaaattatttaatacttctaaagatagtggacaagtagga
ctatttgttctcctaagctttattcaaaacaaaatatttaataatgcaatagaagataaa
gaagcaaaaacagtattagttattgatgaattgcacatgtatattgatccaagcaataca
gctacattagactttgtttatacaatgacaaaaacagttagaaagtttaatgcaggtatg
atactttgtacacagaatccatccgactttttaggttcaagcaatataactaaaaaagct
gaagctatattgcaaaactgtcaatatgctaagttctttggccttaagcaaaaagactta
gaagcagttatggatatgttcaagtcaactggtgggcttaataatacacaccaacgcttt
ttagctgatagcgacgtcggaaacttaatttttagcttacatatgtattcaaaaataaaa
ggcagtatttactacaacgagtatgaaaaacaattattttttgataaaggcataataggt
caataa

DBGET integrated database retrieval system