KEGG   Mycobacterium tuberculosis variant bovis BCG ATCC 35743: BCGT_2103Help
Entry
BCGT_2103         CDS       T03796                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mbx  Mycobacterium tuberculosis variant bovis BCG ATCC 35743
Brite
KEGG Orthology (KO) [BR:mbx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BCGT_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHM08023
Position
2239718..2241376
Genome map
AA seq 552 aa AA seqDB search
MSDNAKHHRDGHLVASGLQDRAARTPQHEGFLGPDRPWHLSFSLLLAGSFVLFSWWAFDY
AGSGANKVILVLATVVGMFMAFNVGGNDVANSFGTSVGAGTLTMKQALLVAAIFEVSGAV
IAGGDVTETIRSGIVDLSGVSVDPRDFMNIMLSALSAAALWLLFANRMGYPVSTTHSIIG
GIVGAAIALGMVSGQGGAALRMVQWDQIGQIVVSWVLSPVLGGLVSYLLYGVIKRHILLY
NEQAERRLTEIKKERIAHRERHKAAFDRLTEIQQIAYTGALARDAVAANRKDFDPDELES
DYYRELHEIDAKTSSVDAFRALQNWVPLVAAAGSMIIVAMLLFKGFKHMHLGLTTMNNYF
IIAMVGAAVWMATFIFAKTLRGESLSRSTFLMFSWMQVFTASGFAFSHGSNDIANAIGPF
AAILDVLRTGAIEGNAAVPAAAMVTFGVALCAGLWFIGRRVIATVGHNLTTMHPASGFAA
ELSAAGVVMGATVLGLPVSSTHILIGAVLGVGIVNRSTNWGLMKPIVLAWVITLPSAAIL
ASVGLVALRAIF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatgccaaacaccacagggatgggcatttggtggctagcggacttcaggat
cgcgcagcgcgcacaccgcaacacgagggcttcctcgggccggaccgaccatggcacctg
tcgttcagtctgctgctggcgggttctttcgtgctgttctcgtggtgggcattcgactac
gcagggtccggcgcgaacaaagtcatcctggtgctcgccaccgtcgtcggcatgttcatg
gccttcaacgtcggcggcaatgatgtcgccaactcgtttggcaccagcgtcggcgcgggc
acgttgaccatgaaacaggcgcttctggtcgcggcgatcttcgaggtcagcggcgcggtg
atcgccggcggcgacgtcaccgagaccatccgcagcggcatcgttgatctgtccggggtg
tccgtcgacccacgcgacttcatgaacatcatgctgtcggcgctatcggcagccgcgctc
tggctgctgtttgctaaccgtatggggtacccggtgtcgaccacacactcgatcatcggc
ggcatcgtcggcgcggcgatcgcgctggggatggtgagcggccagggcggtgccgcactc
aggatggtccagtgggatcaaatcggccagatcgtggtgtcctgggtgctgtcgccggtg
ttgggcggcttggtgtcgtacctgctctacggcgtcatcaaacggcacatcctgctgtac
aacgaacaggccgaacgacggctaacagaaattaagaaagagcgcatcgcacaccgcgag
cgccacaaggcggcgttcgaccggctcaccgagatccagcagatcgcctataccggcgcc
ctggcgcgcgacgccgtcgcggcaaaccgcaaggactttgatcccgacgaactggaatcc
gattactaccgcgagctacacgaaatcgacgccaagacatcgtcggtcgacgcgttccgg
gccctgcagaactgggttccgctggtcgccgccgccggatccatgatcattgtcgcgatg
ctgctgttcaaggggttcaagcacatgcacttgggccttaccacgatgaataactacttc
atcatcgcgatggtcggtgcagcggtgtggatggccacctttattttcgccaagacactt
cggggcgaatcactttcacggtcaacgtttttgatgttcagctggatgcaggtctttacg
gcctcgggcttcgccttcagccacggcagcaatgacattgccaacgccatcgggccgttc
gcggcaatcctggatgtgctgcgcacgggcgccattgaaggcaacgcagcggtgcctgcc
gcggccatggtaacgttcggcgtcgcgttgtgcgcggggttgtggttcattggacgacgg
gtgatcgccaccgttggacacaacctcaccacgatgcacccggcatcggggtttgctgcc
gaattgtcggccgccggggtggtcatgggagccacggtcctgggtcttccggtttccagc
acgcacattcttatcggcgccgtcctcggcgtcggcatcgtaaaccggtccaccaactgg
ggactgatgaaaccgatcgtgctagcgtgggtcatcacgctgccttcggcggcgatcctc
gcctcggtcggtcttgtcgcgctacgcgcgattttctga

DBGET integrated database retrieval system