KEGG   Mycobacterium tuberculosis variant bovis BCG ATCC 35743: BCGT_2458Help
Entry
BCGT_2458         CDS       T03796                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
mbx  Mycobacterium tuberculosis variant bovis BCG ATCC 35743
Pathway
mbx00564  Glycerophospholipid metabolism
mbx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCGT_2458
Enzymes [BR:mbx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     BCGT_2458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF4229
Motif
Other DBs
NCBI-ProteinID: AHM08377
Structure
PDB: 

Position
complement(2614717..2615385)
Genome map
AA seq 222 aa AA seqDB search
MGSATMSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLF
AGACVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAVFCGLLWWIAFHMRDR
PLVIATLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWPP
ALSVGMWLLAVASVITCVQRLHTVWTSPGAIDRMAIPGKGDR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgggctcggcaaccatgagcaagctgcccttcctgtcccgggcggcgttcgcccggatt
accaccccgatcgccaggggactgctgcgggtcggcctcacgccggacgtcgtcaccatc
ctgggcaccaccgcgtcggtggcgggagcgctgacgctgttcccgatgggcaagctgttc
gcgggtgcgtgtgtggtgtggttcttcgtgttgttcgacatgctggacggggcgatggcc
cgggagcgcgggggcggcactcgcttcggcgcggtgctggacgccacctgtgaccgcatc
agtgacggcgcggtgttctgcggtctgctgtggtggatagcgtttcacatgcgcgaccga
ccgctggtgatcgcgaccttgatctgtctggtcacctcgcaggtgatctcttacatcaag
gcccgggcggaggccagcgggctgcgcggcgacggcggcttcatcgaacggccggaacgg
ttgatcatcgtgctgaccggcgccggggtgtcggacttcccgtttgtgccctggccgccg
gcgttgtcggtggggatgtggctgctggccgtcgccagcgtgatcacctgcgtgcagcgg
ttgcacacggtctggacttcacccggagccatcgatcggatggcgattcctggaaagggc
gaccggtga

DBGET integrated database retrieval system