KEGG   Mycobacterium bovis BCG ATCC 35743: BCGT_3422Help
Entry
BCGT_3422         CDS       T03796                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase FadA6
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbx  Mycobacterium bovis BCG ATCC 35743
Pathway
mbx00071  Fatty acid degradation
mbx00072  Synthesis and degradation of ketone bodies
mbx00280  Valine, leucine and isoleucine degradation
mbx00310  Lysine degradation
mbx00362  Benzoate degradation
mbx00380  Tryptophan metabolism
mbx00620  Pyruvate metabolism
mbx00630  Glyoxylate and dicarboxylate metabolism
mbx00640  Propanoate metabolism
mbx00650  Butanoate metabolism
mbx00900  Terpenoid backbone biosynthesis
mbx01100  Metabolic pathways
mbx01110  Biosynthesis of secondary metabolites
mbx01120  Microbial metabolism in diverse environments
mbx01130  Biosynthesis of antibiotics
mbx01200  Carbon metabolism
mbx01212  Fatty acid metabolism
mbx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCGT_3422
   00630 Glyoxylate and dicarboxylate metabolism
    BCGT_3422
   00640 Propanoate metabolism
    BCGT_3422
   00650 Butanoate metabolism
    BCGT_3422
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCGT_3422
   00072 Synthesis and degradation of ketone bodies
    BCGT_3422
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGT_3422
   00310 Lysine degradation
    BCGT_3422
   00380 Tryptophan metabolism
    BCGT_3422
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCGT_3422
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGT_3422
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCGT_3422
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbx04147]
    BCGT_3422
Enzymes [BR:mbx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCGT_3422
Exosome [BR:mbx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCGT_3422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHM09341
Position
complement(3649183..3650343)
Genome map
AA seq 386 aa AA seqDB search
MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS
QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL
TSHERAFAAIRAGHFENEIITVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMA
SQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELE
RIGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcgtacgtcatcgacgccgtacggaccgcggtcggcaagcggggcggcgca
ctggccggtatccatcccgtcgacctgggtgccctggcctggcgcggactgctggaccgg
accgacatcgaccccgccgccgtcgacgacgtgatcgccggatgtgtcgacgccatcggc
ggacaggcgggcaacatcgcccgactgtcgtggctggccgccggctatcccgaagaggtc
cccggtgtcaccgtggaccgccagtgcggatccagccagcaggcgatttcctttggcgcg
caggcgatcatgtccgggacggcggatgtcatcgtggccggcggcgtgcagaacatgagc
cagatcccgatctcgtcggcgatgaccgtgggcgaacagttcgggttcacctcgccgacc
aacgaatccaagcaatggttacaccggtatggcgaccaggagatttcacagttccgtggc
tcggagctgatcgccgagaagtggaacctgtcccgtgaagagatggagcggtactcgctg
accagccacgaacgcgcgttcgcggcgatccgcgccggccacttcgaaaacgaaatcatc
actgtggaaaccgaatccgggccgttccgggttgatgagggcccgcgggagtcgtcgctg
gagaagatggccggcttgcagccgctggtcgagggcggccggctgacggcggcgatggcc
agtcagatctccgacggcgccagtgcagtgttgctggcctccgagcgggccgtcaaagac
catggacttaggccccgtgcccgcatccaccacatcagtgcgcgcgccgccgacccggta
ttcatgctgaccggacccatccccgccacccggtacgcgctggacaagaccgggcttgcc
atcgacgacatcgacaccgtcgagatcaacgaggcgttcgcgccggtagttatggcctgg
ctcaaggaaatcaaggccgacccggcgaaggtcaaccccaacggcggcgcgatcgcgctg
gggcatccgctaggcgccaccggcgccaaactgttcaccaccatgctgggcgagctggag
cgcatcggtggccgctacgggctgcagaccatgtgcgagggcggcggcaccgccaacgtc
accattatcgagcggctgtag

DBGET integrated database retrieval system