KEGG   Methanosarcina barkeri MS: MSBRM_0097Help
Entry
MSBRM_0097        CDS       T03838                                 

Definition
(GenBank) Methyl coenzyme M reductase beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mby  Methanosarcina barkeri MS
Pathway
mby00680  Methane metabolism
mby01100  Metabolic pathways
mby01120  Microbial metabolism in diverse environments
mby01200  Carbon metabolism
Module
mby_M00356  Methanogenesis, methanol => methane
mby_M00357  Methanogenesis, acetate => methane
mby_M00563  Methanogenesis, methylamine/dimethylamine/trimethylamine => methane
mby_M00567  Methanogenesis, CO2 => methane
mby_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mby00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSBRM_0097
Enzymes [BR:mby01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     MSBRM_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N GSDH
Motif
Other DBs
NCBI-ProteinID: AKB53095
UniProt: A0A0E3QPF0
Structure
PDB: 

Position
102113..103417
Genome map
AA seq 434 aa AA seqDB search
MSDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMG
GKGRQILGRGLNYDIVGNADAIAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIA
GADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKAAVWGSYPQTMDLMGGQVQGILSIPQ
NNEGLGFSLRNIMANHVAAISNRNAMNASALSSIYEQSGIFEMGGAVGMFERHQLLGLAY
QGLNANNLLYDIVKENGKDGTIGTVIESVVRRAIEAGIISVDKTAPSGYNFYKANDVPKW
NACAAVGTLAATLVNCGAGRAAQNVSSTLLYFNDILEKETGLPGCDYGKVEGTAVGFSFF
SHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGTQMFSIESTSGLIGDVFGAI
PEFREPIKAVAGVL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacacagtagacatctacgacgacagaggaaaactgctcgagagcaatgtcgac
attatgagccttgctccaacaagaaacgcagcaattcaatcgatcatcatggacactaag
aggtcagttgcagtcaacctcgcaggtattcagggtgcacttgccagtggcaagatgggc
ggaaagggccgtcagatcttaggccgcggacttaactatgacattgtaggcaatgctgat
gcaattgcagaaaatgttaaaaaactcgtccaggtcgatgaaggcgacgataccaatgtc
atcaaagtcaaaggcggaaagagcctcttgatccagtccccaaaatccaggattattgca
ggtgccgacttcatgtccgcaacaacagttggtgcagcagcagtcacccagactattatg
gacatgtttggaaccgatccttatgatgctcctatcgtaaaagcagctgtctggggaagc
tacccacagacaatggatctcatgggcggtcaggttcagggtattctcagcatccctcag
aacaatgaaggtcttggcttctccctcaggaacattatggccaaccacgttgcagcaatc
tccaacaggaatgcaatgaacgcatcagctctctcttccatctacgagcagtctggtatc
ttcgagatgggtggagcagtcggtatgttcgagaggcatcagctcctcggtcttgcatac
cagggtctcaacgccaacaatctcttatacgacattgttaaggaaaacggtaaggatgga
accattggaaccgttatcgaatccgttgtccgcagggcaattgaagctggtattatctcc
gttgacaagaccgctccctctggatacaacttctataaagcaaacgacgtccccaagtgg
aatgcctgtgcagcagtcggtacccttgcagccactctcgtgaactgtggtgcaggccgt
gcagctcagaacgtttcctcaacacttctctacttcaatgatatccttgagaaggaaact
ggtctcccaggatgtgactacggtaaagtagaaggtaccgcggtagggttctcattcttc
agccactccatctatggtggcggtgggcctggtgtcttcaacggtaaccacgtcgttacc
agacactccagaggattcgcaatcccctgtgtatgcgcagcagtcgctcttgatgcaggt
acccagatgttctcaatcgaatcaacatccggcctgataggtgacgtgtttggtgcaata
ccagaattccgcgagccgattaaggcagttgcaggagtgctctaa

DBGET integrated database retrieval system