KEGG   Methanosarcina barkeri MS: MSBRM_0726Help
Entry
MSBRM_0726        CDS       T03838                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mby  Methanosarcina barkeri MS
Pathway
mby00051  Fructose and mannose metabolism
mby00520  Amino sugar and nucleotide sugar metabolism
mby01100  Metabolic pathways
mby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MSBRM_0726
   00520 Amino sugar and nucleotide sugar metabolism
    MSBRM_0726
Enzymes [BR:mby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MSBRM_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep Hexapep_2 NTP_transf_3 Fucokinase DUF4954
Motif
Other DBs
NCBI-ProteinID: AKB53724
UniProt: A0A0E3QT86
Position
942621..943784
Genome map
AA seq 387 aa AA seqDB search
MCGGAGTRLRPLTFKHPKPSIPILNKPSVRHLIEHLSREGFNEIVMTLGYMGERIEEQLG
DGHMFGVHIDYVYEKEKLGTAGGIKNAEKYLKDEPFIVLGGDHVLNLDLREMYRFHEAND
APVTIGLLSIDDPREFGIADMDINNRIHRFLEKPKAGQIFSNLASTGIYVCSPSIFEWIP
EGKKYDFAKDLFPFMLAADKKINGVLVRGQWTDVGSSAAYRQAQRWMLDALPGTTIEGNF
TTRNARIKGPLSIGNNVCIGSNSSLVGPIVIGENTTIGDNVLIGPYSVIGSNCTIEDNAK
ILSSYLFDNVSIGKGSNISGGVVADDTTIGEHCFLENGTVIGHKVLIGSNSTIHSGVKIW
PEVVIDKDSSIKETVINSDYDAAHEGS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaggggctgggacgaggctcaggccgctaactttcaagcatcctaaacccagc
ataccgattcttaataagccttcagtccgacatctgatcgagcatctttcaagggaagga
ttcaatgaaatagtcatgaccctggggtacatgggagagcgcatagaagaacagctcgga
gacgggcacatgtttggggtacatatcgactatgtgtatgagaaggaaaaactcggaact
gcaggcggcattaaaaacgctgagaaatatctgaaagacgagccatttatagtgcttggt
ggagatcacgtccttaacttggacctacgggagatgtaccgtttccatgaagcaaacgat
gccccagtcacaatagggcttctttcgattgacgacccaagagaattcggaattgcggat
atggacattaacaaccggatccaccgctttctggaaaaaccgaaagcaggccagatattc
agcaaccttgcaagcactggcatttatgtttgcagcccttcgatatttgaatggatacct
gaaggcaagaaatacgattttgcaaaagatcttttccccttcatgcttgcagccgacaaa
aaaatcaatggtgtacttgtgagaggacaatggactgacgttggaagttcggcagcttac
aggcaggcacagcgctggatgcttgatgctcttcctggaactacaatcgaaggcaatttc
acaacccggaacgcaagaataaaaggtcctctgtccataggaaataatgtatgtataggt
tcaaattcttctcttgtagggccaatagtaataggggaaaacacaactataggcgataat
gtccttatcgggccttacagcgtgataggttcaaactgcactatagaagacaatgcaaag
atcctttcatcctatctttttgataatgtgtcaatagggaagggttctaacatctcaggt
ggagtggtagcagacgacacaaccatcggagaacactgtttcctcgaaaatggaaccgtt
atcgggcataaagtactgatcggaagtaattcaacaatacattccggagttaagatctgg
cccgaagttgttatagataaagactcaagcataaaggaaaccgtgatcaattccgattat
gatgctgcacatgaaggctcgtaa

DBGET integrated database retrieval system