KEGG   Methanosarcina barkeri MS: MSBRM_1349Help
Entry
MSBRM_1349        CDS       T03838                                 

Definition
(GenBank) Nitrogenase (vanadium-iron) beta chain
  KO
K22897  vanadium-dependent nitrogenase beta chain [EC:1.18.6.2]
Organism
mby  Methanosarcina barkeri MS
Pathway
mby00910  Nitrogen metabolism
mby01100  Metabolic pathways
Module
mby_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:mby00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MSBRM_1349
Enzymes [BR:mby01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.2  vanadium-dependent nitrogenase
     MSBRM_1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: AKB54347
UniProt: A0A0E3QTQ0
Position
1786846..1788183
Genome map
AA seq 445 aa AA seqDB search
MYTCQPAGAQFVGIGIKDCIPLVHGGQGCSMFVRLLFAQHFKENFDIASSSLHESAAVFG
GAIRVEEAVEALIARYPDLRIIPIITTCSTETIGDDIEGIIRKMNKIIKEKHPDRDVKLI
AMHTPSYSGSQVTGYDTAISAVVKALAKKDEPSGKLNIFTGWVNPGDVSEIKHILSEMEV
DGNILLDTETFDAPIMPDKSAFAYGNTTIEEIADSANAIGSIALSRYEGANAATYLKNNF
GVPSVVTPTPIGINNTDIFLKNISKLTGKPIPESLVIERGKAIDAIVDLAHMFFANKKVA
IFGNPDLVFGLAQFCLECELEPVLLLLGDDNTLYKLDPRLESLKEKANCDITVIWNADLW
ELESRIKNKSIDIDLILGHSKGRYIAIDNDIPMVRVGFPTFDRAGLWKYPVIGYKGAEWL
AETIANTIFASMESKHDREWIINVW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtatacctgtcagcctgcaggtgcccaatttgtgggaattggtataaaggactgcatt
ccgcttgtacatggcggtcagggttgcagcatgtttgtcaggttgttgttcgctcagcat
ttcaaagaaaattttgacattgcgtcttcgtctttgcatgaaagcgccgccgttttcggg
ggcgcaataagggtagaagaagcggttgaagcacttattgcgagatatcctgacctgagg
atcatacctattataacgacctgttcaactgaaactattggtgacgatattgaaggtata
atccggaaaatgaataaaataattaaagaaaaacatcctgacagagatgtgaagctcata
gctatgcatacgccaagctacagcgggagccaggtgacaggttacgatacggcaattagc
gcggttgtaaaagctcttgcaaaaaaagatgagccttccggaaagctgaacatattcact
ggatgggtcaatccaggagatgtttctgaaattaagcatatattatctgagatggaggtt
gacggaaatatacttctggacactgagacctttgacgctcctattatgcctgacaaatcg
gcattcgcatatggaaatacaaccattgaggaaatagctgattctgccaatgctatcggg
tcaattgcattaagccgttatgagggcgcaaatgctgcaacatatttaaaaaataacttc
ggcgtgccttcggttgtaactccaacccctataggcataaacaataccgatattttcctt
aaaaatatcagcaagcttacaggcaagcctatacctgaatcactggttattgaacgcgga
aaggcaatagatgcgattgtagaccttgctcatatgtttttcgcgaataagaaagtagcc
atatttgggaatccggaccttgtcttcggtcttgcgcagttttgcctggaatgcgaactt
gaacctgtgcttttacttttgggcgacgataatacactgtataaacttgacccaaggctc
gaatcacttaaagagaaggcaaattgcgatataacagttatctggaacgctgatttgtgg
gaactggaaagccgtatcaaaaacaaatccatagacatcgatttaattttggggcattca
aaaggacgatacattgcaatagataatgatatccccatggtcagggtaggcttcccaaca
ttcgatagagcagggctgtggaaatatccagtaatcggatacaaaggagcagaatggtta
gctgaaacaattgccaatacgatttttgcatccatggaaagtaagcatgacagagaatgg
ataattaatgtctggtaa

DBGET integrated database retrieval system