KEGG   Methanosarcina barkeri MS: MSBRM_2806Help
Entry
MSBRM_2806        CDS       T03838                                 

Definition
(GenBank) Energy-conserving hydrogenase (ferredoxin), subunit A
  KO
K14086  ech hydrogenase subunit A
Organism
mby  Methanosarcina barkeri MS
Brite
KEGG Orthology (KO) [BR:mby00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MSBRM_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M Proton_antipo_N
Motif
Other DBs
NCBI-ProteinID: AKB55804
UniProt: A0A0E3QY90
Position
3680608..3682338
Genome map
AA seq 576 aa AA seqDB search
MYENIVLVLEVLVILYILAVSAKYKNWPTLGLGIISAALFAYTYANVPGAESASFNIDQL
SQLMILIVNIVGTAIILFATGYMDQYEEHRHLNRQRTFYFTMSFFLAAMNGLVMSDTLGW
LYLFWELTTLCSFVLISYNMDEEGINNGFRALSLNLVGGVAMSIGIILLATKYDINSLTG
IATYAGTDAVALAALALPVALLCIGGFAKSAQMPFHSWLLGAMVAPTPVSALLHSSTMVN
AGVFLIVKLVPAFANTSLGTAIAVYGSFTFVICSALALSQRNAKRVLAYSTIANLGLIIA
SAGIGTPLAVAASMMLILFHAISKGLLFLCTGEIEHTIGSRDIEDMSGLIKKAPLLTSIA
ALGMISMLLPPFGVLLTKWVSMEAASNNPVVIIFIVLGSALTTVYYSKWLGTILSSSMDK
NAVPHKKLETYFPLSVLALSIIGTSIFIFSIYNYFVGPQVEILLGNVPNITGPVGQFTSE
IGAFDYAAVFVVLALAILIYLATKNTTTRKVNFYMCGENNLEKDGLMFRNGVCDYEKCSV
SNIYLQNIFGESKLTTFGYAISIILIVIALAGGVGL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaacattgtccttgtactcgaagtactggtaatactatatattcttgctgtg
tcagcaaaatataaaaactggcctacacttggacttggaataatttcagcagccttattt
gcttacacttatgccaatgttccaggtgctgaaagtgcttcttttaatattgatcaactg
tctcagctcatgatattgattgtgaatatagtcggtactgcgattattttattcgcaact
ggatacatggatcagtatgaagagcacaggcatcttaatagacaaaggacattttacttt
acaatgagcttcttcctggcagccatgaatggtctggtaatgtctgacacactaggatgg
ctgtatcttttctgggaactaacaactctgtgttcattcgtgttgatctcatataacatg
gatgaagaaggaataaacaacggtttcagggctctgtccttaaaccttgtcggcggagtt
gctatgtccataggcataattctgcttgcaactaaatatgatataaattcccttactggg
attgcaacttacgctggaactgatgcagtagcgctggccgctttagcccttcctgttgct
ttactctgtattggaggctttgcgaaatctgctcagatgcccttccatagctggctcttg
ggtgcaatggtagctccaactcctgtttctgctttactgcactcaagcacgatggtaaat
gctggtgtgtttttaattgtcaagcttgtaccagcttttgctaatacatccctcggaaca
gctattgcagtttacggtagcttcaccttcgttatctgctcagctttagccttatctcaa
agaaacgccaaaagagtgcttgcttattcaactattgcaaatctaggattaattatcgca
agcgccgggataggcacacctctggctgtagctgcttcgatgatgcttattctgttccac
gctatatcaaaaggtctcttattcctgtgcacaggtgaaattgagcacaccataggaagc
agagatatagaggacatgtcaggattaataaagaaggctcctcttctcacctccattgca
gctctgggaatgatatccatgctattacctcctttcggagtattgcttacaaaatgggta
tcaatggaagctgcttcaaacaaccctgttgtgataatattcatagtacttggaagtgca
ctcaccacagtttattactctaaatggcttggaacaatcttatcatccagcatggataaa
aacgcagttccccataaaaaactggaaacatatttcccactatcggttcttgcgttatcc
attataggtacaagtatctttatattttcaatatacaactacttcgtcggacctcaggtc
gaaattctactaggaaatgttcctaatattacaggaccagttggacaatttacctctgaa
ataggagcatttgattatgcagcagtattcgtagtgctcgctctggctattctgatctac
ctcgctaccaagaacaccacaactcgtaaagttaacttctatatgtgcggggaaaacaac
cttgaaaaagacgggttaatgttcagaaatggagtttgcgattacgaaaaatgcagtgtc
tccaacatctatcttcagaatatttttggagaaagtaaacttacaacatttggatatgca
atttccataattctgattgtaattgcattagcaggaggagtaggattatga

DBGET integrated database retrieval system