KEGG   Mycobacterium bovis ATCC BAA-935: LH58_19255Help
Entry
LH58_19255        CDS       T03363                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbz  Mycobacterium bovis ATCC BAA-935
Pathway
mbz00071  Fatty acid degradation
mbz00072  Synthesis and degradation of ketone bodies
mbz00280  Valine, leucine and isoleucine degradation
mbz00310  Lysine degradation
mbz00362  Benzoate degradation
mbz00380  Tryptophan metabolism
mbz00620  Pyruvate metabolism
mbz00630  Glyoxylate and dicarboxylate metabolism
mbz00640  Propanoate metabolism
mbz00650  Butanoate metabolism
mbz00900  Terpenoid backbone biosynthesis
mbz01100  Metabolic pathways
mbz01110  Biosynthesis of secondary metabolites
mbz01120  Microbial metabolism in diverse environments
mbz01130  Biosynthesis of antibiotics
mbz01200  Carbon metabolism
mbz01212  Fatty acid metabolism
mbz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH58_19255
   00630 Glyoxylate and dicarboxylate metabolism
    LH58_19255
   00640 Propanoate metabolism
    LH58_19255
   00650 Butanoate metabolism
    LH58_19255
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH58_19255
   00072 Synthesis and degradation of ketone bodies
    LH58_19255
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH58_19255
   00310 Lysine degradation
    LH58_19255
   00380 Tryptophan metabolism
    LH58_19255
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH58_19255
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH58_19255
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH58_19255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbz04147]
    LH58_19255
Enzymes [BR:mbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH58_19255
Exosome [BR:mbz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH58_19255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIR48829
UniProt: A0A083VSJ8
Position
complement(3960875..3962035)
Genome map
AA seq 386 aa AA seqDB search
MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS
QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL
TSHERAFAAIRAGHFENEIITVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMA
SQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELE
RIGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcgtacgtcatcgacgccgtacggaccgcggtcggcaagcggggcggcgca
ctggccggtatccatcccgtcgacctgggtgccctggcctggcgcggactgctggaccgg
accgacatcgaccccgccgccgtcgacgacgtgatcgccggatgtgtcgacgccatcggc
ggacaggcgggcaacatcgcccgactgtcgtggctggccgccggctatcccgaagaggtc
cccggtgtcaccgtggaccgccagtgcggatccagccagcaggcgatttcctttggcgcg
caggcgatcatgtccgggacggcggatgtcatcgtggccggcggcgtgcagaacatgagc
cagatcccgatctcgtcggcgatgaccgtgggcgaacagttcgggttcacctcgccgacc
aacgaatccaagcaatggttacaccggtatggcgaccaggagatttcacagttccgtggc
tcggagctgatcgccgagaagtggaacctgtcccgtgaagagatggagcggtactcgctg
accagccacgaacgcgcgttcgcggcgatccgcgccggccacttcgaaaacgaaatcatc
actgtggaaaccgaatccgggccgttccgggttgatgagggcccgcgggagtcgtcgctg
gagaagatggccggcttgcagccgctggtcgagggcggccggctgacggcggcgatggcc
agtcagatctccgacggcgccagtgcagtgttgctggcctccgagcgggccgtcaaagac
catggacttaggccccgtgcccgcatccaccacatcagtgcgcgcgccgccgacccggta
ttcatgctgaccggacccatccccgccacccggtacgcgctggacaagaccgggcttgcc
atcgacgacatcgacaccgtcgagatcaacgaggcgttcgcgccggtagttatggcctgg
ctcaaggaaatcaaggccgacccggcgaaggtcaaccccaacggcggcgcgatcgcgctg
gggcatccgctaggcgccaccggcgccaaactgttcaccaccatgctgggcgagctggag
cgcatcggtggccgctacgggctgcagaccatgtgcgagggcggcggcaccgccaacgtc
accattatcgagcggctgtag

DBGET integrated database retrieval system