KEGG   Methylococcus capsulatus: MCA0691Help
Entry
MCA0691           CDS       T00205                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
mca  Methylococcus capsulatus
Pathway
mca03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MCA0691 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mca03400]
    MCA0691 (recB)
Enzymes [BR:mca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCA0691 (recB)
DNA repair and recombination proteins [BR:mca03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MCA0691 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 PDDEXK_1 AAA_30 AAA_11 DUF374 ResIII
Motif
Other DBs
NCBI-ProteinID: AAU93177
UniProt: Q60AZ5
Position
723270..726872
Genome map
AA seq 1200 aa AA seqDB search
MSAVRPLDVFRCPLAGVNLIEASAGTGKTWNICGLYLRLLLEQEREVQNILVVTFTNAAT
AELRERIRSRIVETLVYLRGGGGAADPFVTGLVAALEGGFDRALLRQRLERALLAFDEAA
IFTIHGFCQRALAGTPFAAGLPFALELVQDDAMLAQEVANDFWRRRVAAGGLSRAMIAHL
LEAGDDPEKYASLLGHALAKSLSDWRWPEPVEPPDERDEQALLAAFGEARRLWQADAFGI
VRLLEEAIDQLNGVSYKAASLETARKGWDAWFATNDPLAPVEDKVQLFRAAMLKGGTKKG
NTTPYHPFFDAAENLLALKDGIQGRLAVARLGLLRELVEHGAEALRAEKRRRRVIGFDDM
LWNVHEALTSGCYPWLAPALRSRYPVALIDEFQDTDPLQFAIFRALYLAEGAVSGPVFFV
GDPKQAIYGFRNADLYTYLGARHQADREYTLVENQRSVTEVIDACNALFGANPRAFLLEG
LEYRPVRPGAKPRPVFTDVTEPRSPFQVWLLPRDEAGGWLPRTEAVRRCTDTTAAEIARL
IQEGMAGRIRLGERALRASDIAVLVRRHAQGRLIRQALARLGVGSVELSQASVFHTLEAE
EIERILLAVLEPGRDRLLRAALATEIMGCDALTIAGISADEDRLLEIMLRFGEYRELWQL
RGFGPMYRRLLHDEGVARRVLAQPDGERRLTNLLHLGELLHQAQAGLTSPDALLRWLQSR
RRDSAAQEDAQLRLESDQNLVQIVTIHKSKGLEYPVVFCPYLWEGNRGARGKQEGIEYHD
ESGVPVLDFRPEAKNDPGIKWQRRQEEDAETLRLIYVALTRAVQRCYLFAGVYRTKREAS
ASCGESTRSMLNWLACGKDHSPEQWQDAKTRLDPAHIEAGWRALPDAIGVAPMPAIVVPA
MAGPSSGLERLAAQTPPAWIPPGWSTGSFTSLVRAMEAGGEGRDHDALSLAPALGPPPAA
LPENDILRFPRGAAAGTCIHHLFEQADFTDPAGWDDAIGRALALRPQGSETAAPAMLKSL
LADVLATDLGDGLRLSEIGRGQRLSELAFRLPAEGLDPVRLNALLRDHGYAMGKLDFRLL
SGYLQGAIDLVFRHRSRYYLLDWKSNHLGYTREDYGPPALAETMAAEGYHLQYLLYTVAL
DRYLARRLPGYAYTSHFGGVYYLFVRGVRPAWRGAGVYFQRPAEDCIAALDALIGGRRGA
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggtacgacccctggacgtattccgctgtccgctggcgggcgtcaacctgatc
gaggcctccgccggcactggcaagacctggaacatctgcggtctgtatctgcgactgctg
ttggagcaggagcgggaggtccagaacatcctggtcgtgaccttcaccaatgcggcgacg
gccgagttgcgcgagcgtatccgcagccggatcgtcgagaccctcgtgtacttgcgggga
ggaggcggagccgccgatcctttcgttaccggcctggtggcggcgctcgaaggcgggttc
gaccgggcgctgctgcggcagcggctggagcgggcgctgctggctttcgacgaggcggcg
atcttcaccatccacggcttctgccagcgcgccctggccggtacccctttcgccgccggt
cttccgttcgccctggaactggtgcaggacgacgcgatgctggcacaggaagtcgccaac
gatttctggcgccggcgcgtcgcggccggaggtttgagccgggccatgatcgcccatctg
ctggaggccggcgacgatccggagaaatacgccagtctgctcggacacgcgctggccaag
tcgctctcggactggcgttggcccgagccggtggagccgccggatgagcgggacgagcag
gctttgctggccgcgttcggtgaggcacggcggctgtggcaggccgatgcgttcggcatc
gtccggctgttggaagaggcgatcgatcagctcaacggcgtatcctacaaagcggcgtcc
ctcgagacggcacggaagggctgggatgcgtggttcgctacgaacgatccgctggcgccc
gtggaggacaaggtccagctgttccgggcagcgatgctgaaggggggaacgaaaaagggc
aacacgacgccctaccatccgtttttcgatgcggccgaaaatttgctggcgctcaaagac
ggcatccaggggcgcctggcggtcgcgcgtctgggtctgctccgggagctcgtcgaacat
ggcgcggaggcgctgcgggcggagaaacgccggcggcgggtcatcggtttcgacgacatg
ctgtggaacgtccacgaggccctgacttcggggtgctatccgtggctggctcctgccctg
cgcagccgttatccggtggcgctgatcgacgagttccaggacaccgatccactgcagttc
gccatcttccgggcgctctacctggccgaaggcgcggtgtccgggccggtgttctttgtc
ggcgaccccaagcaggcgatctacggcttccgcaacgccgatctctacacctatctcggc
gcacgccaccaggccgaccgcgaatacaccctggtggagaaccagcgttcggtgacggaa
gtgatcgatgcctgcaacgccttgttcggcgccaacccccgtgctttcctcctcgagggc
ctcgagtaccgcccggtcaggccaggagcgaagccgcgtccggttttcaccgacgtcacc
gagccgcgctcgccgttccaggtctggctgctgccgagagacgaggcgggcggctggttg
ccgcggacggaggcggtgcggcgctgtaccgacaccacggcggccgagatcgcccgcctg
atccaggaaggcatggcggggcgtatccggctcggcgagcgggccttgcgcgcatcggac
atcgcggtgctggtgcgccgtcatgcccagggccggcttatccgccaggcgctggcaagg
ctgggggtgggcagtgtcgagctgtcgcaggccagtgtgttccacacgctcgaggcggag
gaaatcgagcgcatcctgctggcggtgctcgagcccggccgagaccgcctgctgcgggcc
gcgctggcgacggagatcatgggctgcgatgcgctgacgatcgccgggatttcggcggac
gaggaccgtttgctggaaatcatgctgcgcttcggcgaatatcgcgagctgtggcagctg
cgcggcttcggaccgatgtatcggcggcttctgcacgacgagggcgtggcccgccgggtg
ctggcccagcccgatggcgagcgccgtctgaccaatctgttgcacctgggggaactgctg
caccaggctcaggccggactgacttcgcccgatgccctactgcgctggctgcagagccgg
aggcgggacagcgcggcgcaggaagacgcccagctgcgactggagtccgaccagaatctg
gtgcagatcgtcaccatccacaagtccaagggcttggagtatccggtggtgttctgcccc
tatttgtgggaagggaaccgcggcgcgcggggcaagcaggagggcatcgaatatcatgac
gaatccggtgtcccggtgctggattttcgtccggaagccaaaaatgatcccgggatcaag
tggcagcgccggcaggaagaggacgccgagaccctacgcctgatctatgtggccctgacc
cgcgcggtgcagcgctgttatctatttgccggcgtttaccggaccaagagggaggcttcg
gcgtcttgtggtgaaagcacccgcagcatgctcaactggctcgcctgtgggaaggatcac
agtcccgagcaatggcaggacgccaagacccggctcgatccggcgcatattgaggccggt
tggcgcgctttgccggacgcgatcggcgtcgcgccgatgccggccattgtcgtaccggcg
atggccggaccttcgtccggcctcgagcggctggcggcgcagacgccgccggcctggatt
cctccgggctggtccacgggcagctttacctccttggtccgggccatggaggccgggggg
gagggacgcgaccacgatgccctcagcctggcgccggccctggggccgccgccggcagcg
ctgcccgagaacgacatcctgcgttttccgcggggcgctgcggccggcacctgcatccac
catctgttcgagcaggccgatttcaccgatcccgccggctgggacgatgccatcggccgc
gccctggcgctgcggccgcagggctcggaaacggcggctcccgccatgctgaagagcctc
ctggccgacgtgttggccaccgatctgggcgacggcttgaggctgagcgagataggccgg
gggcagcggctgagcgagctcgccttccgcctgccggccgaggggctggacccggtgcgg
ctgaacgcgttgctgcgcgatcatggctatgccatgggcaagctggatttccggttgctg
agtggctatctgcagggcgccatcgatctggtgtttcgccaccggagccgctattacctg
ttggactggaaatccaaccatctcggctacacgcgcgaggactacggcccgccagcgctg
gcggaaaccatggccgcggagggttatcacctgcaatacctgctctatacggtcgcgctc
gaccggtacctcgcccgccgcctgccgggctatgcttacacgagccactttggcggcgtg
tattacctgttcgtacgcggtgtgcggccggcctggcggggggccggtgtctatttccaa
cggcctgctgaggactgcatcgccgcgctggatgctttgatcggcgggaggcgaggcgca
tga

DBGET integrated database retrieval system