KEGG   Methylococcus capsulatus: MCA0967Help
Entry
MCA0967           CDS       T00205                                 

Gene name
sucC-1
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mca  Methylococcus capsulatus
Pathway
mca00020  Citrate cycle (TCA cycle)
mca00640  Propanoate metabolism
mca00660  C5-Branched dibasic acid metabolism
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
mca01130  Biosynthesis of antibiotics
mca01200  Carbon metabolism
Module
mca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCA0967 (sucC-1)
   00640 Propanoate metabolism
    MCA0967 (sucC-1)
   00660 C5-Branched dibasic acid metabolism
    MCA0967 (sucC-1)
Enzymes [BR:mca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MCA0967 (sucC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AAU92720
UniProt: Q60AA1
Position
1010404..1011564
Genome map
AA seq 386 aa AA seqDB search
MNLHEYQSKRLLADYGVPVPRGGVAFSPDEARSCALQIGGERWAVKAQVHSGGRGKAGGV
KLCSSEDEVAAAAHALLGSELVTSQSGGKGLPVHAVLVEEVRGIAREIYLSVLVDRSSAT
IMFLASGEGGMDIEAVAAGSPEKILSSRIHPAAGFQPYQGRDIGYALGLDAAQIGTLVRL
MAGMYRLFVEKDLSQIEINPLIVTAEGELLALDAKIGIDDNALFAHPELAGLRDASQEDA
RENAAREHGLSYVTLGGNIGCMVNGAGLAMATMDMVKLHGGEPANFLDVGGGATAEKVAE
AFKLILSDSGVRAVLVNIFGGIVRCDLIAEGLIAAVREVRVGVPVVVRLEGTNAGEGRAL
LERSGLAIIAADELDEAARKAVEAAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaataccaatccaagcggctgctcgccgactacggcgtgcccgtgccg
cgcggcggtgtcgctttttccccggacgaggcccgttcctgcgcgctgcaaatcggtggc
gagcgctgggccgtgaaggcgcaggtgcattcaggcggacgcggcaaggccggcggcgtg
aagctgtgcagcagtgaagacgaggtggccgcggcggcgcacgcgttgctgggttccgaa
ctcgtgaccagtcagagcggtggcaaagggctgcccgtccatgccgtcctggtcgaagag
gtgcgcggcatcgcgcgtgagatctacctgagtgtcctggtcgaccgctccagcgcgacg
atcatgttcttggcctccggcgaaggcggcatggacatcgaagccgtggcggccggatcg
ccggagaagatactttccagccgtatccatccggccgccgggttccagccgtaccaggga
cgggacatcggttatgccctggggttggatgcggcccagatcggcacattggtccggctg
atggcgggcatgtaccgcctgttcgtggagaaggatctgagccagatcgagatcaatccc
ctgatcgtcacggcggaaggcgaattgctggcgctggacgccaagatcggcatcgatgac
aacgcgctgttcgcccaccccgagctggccgggcttcgcgatgcaagccaggaggacgcg
cgcgagaatgccgcgcgcgagcacgggctgagctatgtcaccctgggaggcaacatcggc
tgcatggtcaacggcgccggtctggcgatggccaccatggacatggtcaagctgcacggc
ggggagcccgccaattttctcgacgtcggcggcggcgcaaccgcggaaaaagtggccgag
gccttcaagctgatcctgtccgattcgggggtgcgggccgtgctggtcaacatcttcggc
ggtatcgtccgctgcgatctgatcgcggaagggctgatcgccgcggtgcgcgaagtgcgg
gtcggtgtgccggtggtggtccggctggaaggcaccaacgccggcgagggccgggctctg
ctggagcgttcgggtcttgccatcatcgccgccgatgaactggacgaggcggcgcgcaag
gcggtggaggcggcggcatga

DBGET integrated database retrieval system