KEGG   Methylococcus capsulatus: MCA1190
Entry
MCA1190           CDS       T00205                                 

Definition
(GenBank) hypothetical protein
Organism
mca  Methylococcus capsulatus
SSDB
Motif
Pfam: Rubrerythrin DUF455 COQ7
Other DBs
NCBI-ProteinID: AAU92740
UniProt: Q609P2
Position
1247103..1248005
AA seq 300 aa
MATGKPKAGSAEHRELFCRSFIDSHLRFEPERLAWPELDPDMLQRLREVPFWQEVLYTEM
RAIRIIEAFAPTIPDPLVREAMELMAEEERRHERLVRHLIARYGIVIEARDNPPLPSDIE
RTFIDFGYGECVDSFLGFGFFRLARESGFLPPEMFDVLEILMGEEVRHVLFFVNWMAWHQ
ARRGRGAAAWRGPASAWYYARAVAALVGVALRNARQQGNGREFSATQAAGLMPGFTVGGL
LDACLEENRRRLDGYGRDLLRPLFLPALARFALRLTGRRIPEDMREEGSLMRRVWTVLRG
NT seq 903 nt   +upstreamnt  +downstreamnt
atggcgacagggaaaccgaaggcgggttcggcggagcaccgggaattgttctgtcggagc
ttcatcgacagccatctgcgcttcgagccggaacggctggcgtggcccgaactggacccg
gacatgctgcagcggctcagggaggtgccgttctggcaggaggtcctgtacaccgagatg
cgggcgatccggatcatcgaggcattcgcgccgaccattccggaccctttggtacgcgag
gccatggaattgatggccgaggaggaaaggcgccacgagcgtctggtccgccacctgatc
gcccgctacgggatcgtgatcgaagccagggataacccgcctttgccgtcggacatcgaa
cggacgttcatcgatttcggctacggcgaatgcgtggattcgttcctggggttcggcttc
ttccgtctcgcgcgggagagtggattcctgccgccagagatgttcgacgtcctggagatc
ctcatgggggaggaggttcgccatgtgctgttcttcgtcaattggatggcctggcatcag
gcacgccggggacggggcgcggcggcttggcgcgggccggcctcggcatggtattacgcc
cgcgcggtcgcggcgctggtgggcgtcgccctgcggaacgcccgccaacagggcaacggc
cgggagttttctgctacccaggcggccggtctgatgccgggcttcacggtgggagggctg
ctcgatgcctgtctggaggaaaaccggcggcggctggatggctacggtcgggatctgttg
cgcccgctttttttaccggccctggcgcgcttcgcactaaggttgaccggcaggcggata
cctgaggacatgagggaggaaggaagtttgatgcggcgggtatggaccgtactacgcggt
tag

DBGET integrated database retrieval system