KEGG   Methylococcus capsulatus: MCA1191
Entry
MCA1191           CDS       T00205                                 

Definition
(GenBank) SCO1/SenC family protein
  KO
K07152  protein SCO1
Organism
mca  Methylococcus capsulatus
Brite
KEGG Orthology (KO) [BR:mca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mca03029]
    MCA1191
Mitochondrial biogenesis [BR:mca03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    MCA1191
SSDB
Motif
Pfam: SCO1-SenC AhpC-TSA Lyase_1 VirJ
Other DBs
NCBI-ProteinID: AAU92739
UniProt: Q609P1
Position
1247984..1248646
AA seq 220 aa
MDRTTRLDRGSVRRGLSRFAATAMIAAVTLALGLSAWHEHAERAGALVSGTLLREPRPVA
DFVLTGDDGRPFTRTDLAGRWTVVFVGYTHCADVCPTTLSHLKAARSRLGGEGERLTVLF
VSVDPERDTPDSLRRYVRYFDQGFRAATGTVEALTALGRQLGFVFFRNSAADGEGYGIDH
SAELMLLDPKVRLVGYLIPPFRIEALAADFETILGKRVAP
NT seq 663 nt   +upstreamnt  +downstreamnt
atggaccgtactacgcggttagatcgcggctccgtccggcgcggcttgtcgaggtttgcg
gcgaccgcgatgatcgccgcggttactctggccctcggtcttagtgcctggcatgagcat
gcagagcgcgccggtgccctggtgtccggcacgctactgcgggagccgcgccccgtcgcc
gatttcgtattgaccggtgacgacggcagaccgttcacgcgaaccgatctggccgggcgc
tggaccgtcgtcttcgtcggctatacccactgcgccgacgtctgtcccaccacgctgtcc
cacctcaaggcggccaggtccagactcggcggagagggggagcggctgacggtgctgttc
gtgtcggtcgatccggagcgtgacacaccggattctttgcgacgctacgtgcgttatttc
gaccaaggtttccgggcggccactggtacggtggaggcactcacggcgctggggcgccag
ctcggcttcgtatttttccggaattccgccgcggacggcgagggctatggcattgatcat
tccgcggagctgatgttgctcgatccgaaggtccgtctggttggctatctgatcccgcct
ttccggatcgaagccctggccgcagatttcgagacgatactcgggaaacgggttgcccca
tga

DBGET integrated database retrieval system