KEGG   Methylococcus capsulatus: MCA1739Help
Entry
MCA1739           CDS       T00205                                 

Definition
(GenBank) putative citrate lyase, beta subunit
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
mca  Methylococcus capsulatus
Pathway
mca00630  Glyoxylate and dicarboxylate metabolism
mca00660  C5-Branched dibasic acid metabolism
mca00680  Methane metabolism
mca01100  Metabolic pathways
mca01120  Microbial metabolism in diverse environments
mca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MCA1739
   00660 C5-Branched dibasic acid metabolism
    MCA1739
  09102 Energy metabolism
   00680 Methane metabolism
    MCA1739
Enzymes [BR:mca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     MCA1739
    4.1.3.25  (S)-citramalyl-CoA lyase
     MCA1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AAU91977
UniProt: Q607M0
Position
1856611..1857573
Genome map
AA seq 320 aa AA seqDB search
MAVKNRLHRSELAVPGSNPRMLEKAPEAGADIVFLDLEDAVAPDDKEQARRNIVFALNTY
DWSRCAVSVRINGLDTHYAYRDLVEIVESCGDKLDTILVPKVGSASDVLFVATLLSQIEA
YKGFKPINIHVLIETAMGMANVEEIARTCPERMEAMVFGVADYAASVRARTTNIGGANPD
YGMLTDPDESGTRAYHWADQWHFGISRMVAACRAYGLRPIDGPFGDFSDPEGFRAAARRA
AALGCEGKWAIHPSQIPLCNEIFTPTEKEVTRAYRILEAMEQAAKEGKGAVSLDGRLIDA
ASIRMAENVVRQMKQIESRR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagaaccgtctacaccgcagcgaactcgcggtgccgggcagcaatccacgc
atgctcgagaaagcgccggaagccggcgccgacatcgtctttctggacctggaagatgcg
gttgcgccggatgacaaggagcaagcgcgccggaacatcgtcttcgcgctcaacacctac
gactggtccagatgcgcggtctccgtccgcatcaacggcctcgacacccattacgcctac
cgggacctcgttgagatcgtcgagtcctgcggcgacaagctcgacaccattctggtgccg
aaagtcggcagcgcctcggacgttctgttcgtcgcgactttactttcccagatcgaggcc
tacaaaggtttcaaaccgatcaatatccacgtgctgatcgaaacggccatgggcatggcc
aacgtggaggagatcgcccgcacctgtcctgaacgcatggaggccatggtgttcggcgtg
gccgactacgctgcgtcggtgcgcgcccgcacgaccaacatcggcggcgccaacccggat
tacggcatgctgaccgaccctgacgaaagcggtacccgcgcctatcactgggccgaccag
tggcatttcggcatttcccgcatggtcgcggcctgccgcgcctatgggcttcgccccatc
gacggccccttcggcgatttcagcgatccggaaggattccgcgccgcagcccgccgtgcc
gcggcactgggctgcgaagggaagtgggcgatccatccctcccagattccactgtgcaac
gaaatcttcacacccacggaaaaagaggtcacgcgggcctaccgcatcctggaagccatg
gagcaggcggcaaaggagggcaaaggcgcggtgtctctggatgggcggctgatcgatgcc
gcctcgatccggatggcggagaacgtggtccgccagatgaagcagatcgagtcgcgtcgg
tag

DBGET integrated database retrieval system