KEGG   Methylococcus capsulatus: MCA1915
Entry
MCA1915           CDS       T00205                                 

Definition
(GenBank) cation-transporting ATPase, E1-E2 family
Organism
mca  Methylococcus capsulatus
Motif
Pfam: EcsC E1-E2_ATPase Hydrolase HMA_2 DUF5927 STALD
Other DBs
NCBI-ProteinID: AAU92110
UniProt: Q606U9
Position
2059046..2062252
AA seq 1068 aa
MAGRIAFGSSWLRIEDTGVFGPGRAKIARRFARRVFTLPEVESLELEPSRGCALIRHRTA
KTGVDAFRRRLAAAVDVEEEGRADRDLPQWPADSPVTLHRHDDLISLFRIGSAANGWLEL
QHPSLQGNAVRLRTIEAALGALDAVRGVSGHAASGTIRIRYHAGSLEPAALLRVAEGLLI
AETASCIPEPAAVDFRVANASVGLGAVGELMLPLATPLAAGLLVAGNLRVLQDAGKQISH
GKLGVAVFHTALLACSIATGQVLAYALTEWSLRYWQQNWRKHLTRETRALLEDNLPIPAQ
TVLLSPEGIESRVAPSDLRAGDRVKVSAPRIIPVDGVVLAGQALVQESSLRGRPGLVRKT
AGDEVLAGTVVANGSLDIQAVCTGPETRAAGLTRQVLDTASLMPADRTMRRRAEELADRT
VFPTLATAGVGWAVGDLITVGAILHQDWVSGPGMVLPMETLRAMRLAWRAGALLKSASAL
ARMKYSDFLVIDGDLPGLLDPQLELAEVASQAPYTDTILRHAAGAGLFLGDERAEALARS
CAQRGLVVREPELLSLDANAVEVRSGRHTVSLTGALSHSEAVTAPLRMRIDGTDVAELRF
TYSHRPRASQTLASLRALGMRQIFVVSSRPEAETAELMRRLGADLSGGGLNAEQKIRFLR
GLKNRGVRTTLVGDFDKESEMAGEAHVTVGLVNPLGDSGPCDIALLSESLDPLVALMELA
RSHDANVVSACRMAAIPNLLCIAGAFAGILNGITSGIIANLGVVNVDRRLRRNLQMAKGA
SRSASALNKPGARRSPEPSPPVLLIGMKHLIPAMPPSHYEAEQIRAIAAWKRRKPHLASP
LLNRARRPLVRLGRKIIPAPASRFALDALNKMAEQLVRDDWILRHGGIRSLEEIGAQSLE
FSDRLADKVIEEGLKLATGVGAVTGTGSLGTVLVGVPASLGVALRLIHRVSQAYGYSTER
TGDRGFMLHILALATAETAEERTRALENYHWQLEHHLVGDAVNDAALAVLQRIVFGRKLA
SFVPGLSVALNAYANRSFSRRAGLAAKHVYQERWLLDRGRIAGWVAPT
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggccggtaggatcgcgttcggttccagctggctacgcatcgaggatacgggggtcttc
ggccccggccgagcgaagatcgcccgccgttttgcccggcgggtgttcaccctcccggaa
gtcgagtcactcgagctggaaccctcccggggatgtgcgctcatcagacaccgcaccgcg
aagacaggcgtcgacgctttccgccggcggctggccgccgcggtggacgtcgaggaagaa
gggcgggcagaccgggatttgccgcagtggccggcggattcccccgtcacgctgcatcgg
catgacgacctgatctcgctgttccggatcgggtccgccgccaatggctggctcgaattg
caacatccgtccttgcagggcaatgccgtacgtctccgaaccatcgaagccgcgctcggc
gcactcgatgccgtccggggtgtttctggccatgccgcttccggcacgatccgaatacgt
taccacgccggttcactggaaccggccgctctgttacgcgtcgccgaggggcttctgatc
gccgaaacggcatcatgcattcccgaacccgcggcggtggatttccgggtcgccaacgcc
agtgtcggactcggcgccgtgggggagttgatgctgccgctcgcgacgccgctcgcggca
ggtctgctggtggcgggcaatctccgggtgctgcaggatgccggcaagcagatcagccac
gggaaactgggcgtggcggtgtttcacaccgccctgctcgcctgctcgatcgccaccggc
caggtcctcgcgtatgccctgaccgaatggtctctgcgctattggcagcagaactggcgg
aagcatctgacccgggaaacccgggcgcttctggaagacaacctgccgattccggcacag
accgtcctgctgagccccgaaggcatcgagtcacgggtcgctccctccgatctgcgcgcc
ggcgaccgggtcaaagtctctgcgccccggatcatcccggtcgacggcgtcgtcctcgcc
ggccaggccctggtccaggaatccagccttcgcggacgtccgggcctggtacggaaaaca
gccggcgacgaagtgcttgccgggaccgtcgtggccaacggttccctggatatccaagcc
gtctgcaccggaccagagacccgggccgccggtctcacaaggcaggtcctcgacaccgcc
tccctgatgcccgccgaccgaaccatgcgacgccgagcggaagaactggcggaccgcacg
gtgttccctactctggccaccgccggcgtaggctgggccgtgggcgacctgatcacggtg
ggcgccatcctgcatcaggactgggtcagcggccccggtatggtcctgccgatggagaca
ctccgggccatgcggctggcctggcgcgccggtgccctgctcaaatccgcttcggctctc
gcccgcatgaagtacagcgacttcctggtgatcgatggcgatctgccgggcctcctcgat
ccgcagctcgagctggccgaagtggccagccaggcgccgtacaccgacacgatcctgcgg
cacgccgcgggcgccggactgttcctcggcgacgaacgcgccgaggcgctggcccgaagc
tgcgcccagcgtgggctggtcgtccgcgagccggaactgctgtcgctggacgccaatgcg
gtcgaggtgcggagcggccgccataccgtcagtctgacgggagctctcagccactccgag
gcagtcacggcgccattgcggatgcgcatcgacggcaccgacgtcgcggagctgcggttc
acttactcgcaccggccgcgggcaagccaaaccctcgcctctctccgcgcgctcggcatg
cggcagatattcgtcgtctcgtcacgccccgaggccgaaaccgccgaactcatgcgccgc
ctcggtgccgatctttccggcggcgggctgaacgcggagcagaagatccgctttctacgg
gggctgaaaaaccggggcgtgcggaccacgctggtcggcgacttcgacaaggagtccgag
atggcgggcgaagcccatgtcaccgtcggcctggtaaacccgctgggtgacagcgggccc
tgcgacatcgcgctcctgagtgaatcgctcgatcccctggtcgctctgatggagctggcc
cgaagccatgacgccaacgtcgtttcggcctgccgtatggcggctatcccgaatctgctt
tgcatcgccggcgccttcgccggtatcctcaacggcattacttccggcatcatcgccaac
ctcggtgtcgtgaacgtcgaccgccgtctgcggcgaaacctgcagatggcaaagggtgcg
tcgcgttccgcttctgcgctgaacaagcccggcgctcgccggagtccggagccctctccg
ccagtcttgctgataggcatgaaacacctcattccagccatgccaccgagccattacgaa
gccgaacagatccgggccatcgccgcatggaaacggcgtaagcctcatctggcgagcccg
ctcctgaaccgcgcgcggcggccgctggtccggctgggccggaagatcatacccgcccct
gcttcgcgattcgcgctcgacgccctcaacaagatggccgaacaactggtacgggacgac
tggatcctgcgccacggtggaattcgcagcctggaggaaatcggcgcgcagtcgctggaa
ttcagcgaccgcttggccgacaaagtcatcgaagaaggactcaaactcgccaccggtgta
ggcgccgtgaccggcacgggcagcctgggtaccgtcctagtgggcgttccggcatcgctg
ggcgtggcgctgcggctgatccatcgcgtgtcccaggcctatggctattccacggagcgc
acgggtgaccgcggcttcatgctgcacatcctggcgctggccaccgccgaaacggccgag
gaacgaacgcgcgccctggagaactatcattggcagctcgagcatcacctcgtcggcgac
gccgtgaacgacgcagcgctggcggtactgcagcggatcgtgttcggccgcaagctggca
tcgttcgttcccggcctgtccgtcgcgctcaatgcctatgccaaccggtccttcagccgg
cgcgccggcctcgccgccaagcacgtttaccaggaacgctggctgctcgatcgcggcagg
atcgcaggctgggtagcacccacgtga

DBGET integrated database retrieval system