KEGG   Methylococcus capsulatus: MCA2203Help
Entry
MCA2203           CDS       T00205                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mca  Methylococcus capsulatus
Pathway
mca00040  Pentose and glucuronate interconversions
mca00052  Galactose metabolism
mca00500  Starch and sucrose metabolism
mca00520  Amino sugar and nucleotide sugar metabolism
mca01100  Metabolic pathways
mca01130  Biosynthesis of antibiotics
Module
mca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MCA2203 (galU)
   00052 Galactose metabolism
    MCA2203 (galU)
   00500 Starch and sucrose metabolism
    MCA2203 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MCA2203 (galU)
Enzymes [BR:mca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MCA2203 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DUF3137
Motif
Other DBs
NCBI-ProteinID: AAU91554
UniProt: Q605S5
Position
complement(2380159..2381037)
Genome map
AA seq 292 aa AA seqDB search
MAKVIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAVAAGIDEMVFITGR
SKNAIMDHFDKAYELETELAARGKDDILNIVRNIIPPHVTCIYIRQAEALGLGHAVNCAK
AVIGNQPFAVLLADDLIDGNNHGGCLSQMVRVFDKWQCSVLGIERIDPGDTHSYGIVKTS
PIEAGLDKVEAIVEKPRPENAPSNQAVVGRYILTPAIFDKLANVSRGAGGEIQLTDAIAM
LLNEQTVLAYEFNGKRYDCGSKLGYLIATVEQGLQHPDLRAGFEAYLRSLQL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtcatcagaaaagccgttttcccggtcgcggggctggggacccgcttcctg
cccgccaccaaggccagcccgaaggaaatgctgccggtggtggacaagccgttgatccaa
tatgcggtggaagaagccgtggcggccggcatcgacgagatggtgttcatcaccggccgc
agcaagaacgcgatcatggaccatttcgacaaggcctacgaactcgagacggaactggcg
gcgcgaggcaaggacgacatcctgaacatcgtccggaacatcattccgccgcacgtcacc
tgcatctacatccgtcaggccgaagcgctggggctgggccatgccgtcaactgcgccaag
gcggtcatcggcaaccaaccgttcgcggtgctgctcgccgacgatctcatcgacggcaac
aaccacggcggctgtctgtcacagatggtccgggtattcgacaaatggcagtgctcggtg
ctgggcatcgagcgcatcgatcccggcgacactcacagctacggcatcgtgaagaccagt
ccgatcgaggccgggctggacaaggtcgaagcgatcgtggaaaagccgcggcccgagaac
gcgccatccaaccaggccgtggtgggacgctacatcctcacgccggcgatcttcgacaag
cttgccaatgtctcgcgcggcgcgggcggggaaatccagctcaccgacgccatcgccatg
ctgctcaacgagcagacggtgttggcctacgaattcaacggcaagcgttacgattgcgga
tcgaagctgggctatctcatcgccacggtggaacagggcctgcagcatcccgatttgcgg
gctggcttcgaagcctatctgcggagtctgcagctctag

DBGET integrated database retrieval system