KEGG   Methylococcus capsulatus: MCA3001Help
Entry
MCA3001           CDS       T00205                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mca  Methylococcus capsulatus
Pathway
mca00010  Glycolysis / Gluconeogenesis
mca00020  Citrate cycle (TCA cycle)
mca00620  Pyruvate metabolism
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
mca01130  Biosynthesis of antibiotics
mca01200  Carbon metabolism
Module
mca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCA3001 (aceF)
   00020 Citrate cycle (TCA cycle)
    MCA3001 (aceF)
   00620 Pyruvate metabolism
    MCA3001 (aceF)
Enzymes [BR:mca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MCA3001 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: AAU90978
UniProt: Q602R1
Position
3176376..3177686
Genome map
AA seq 436 aa AA seqDB search
MAQEQTVVVPDIGDFKDVEIIEVLVKPGDKVAANDSLITLESDKAAMEIPSPYSGTVTEL
HVRVGSKVSMGTPILQLREDEGTDASGAASAPVEPAPAEPVSPPPAAAAPAAGDTQAVPA
SAPTPPAPMPVAEEGSGPAHASPAVRRFARELGVDVAKVRGTGPKGRILKTDVQSFVKQA
VATAERTGGGGFAVPAMPEIDFAQFGPIERQPLSRIQKLSSANLHRTWLTVPHVTQHDEA
DITELEAFRNALKAESAKRGVKLTLLPFIIKAAVAALKDFPRFNASVAPNGEELILKRYY
HVGFAVDTPDGLVVPVIRDADTKGIWDIAAELAAIGDKARGKKLRTADLQGGTFTVSSLG
GIGGIAFTPIINAPEVAILGVSKAQLRPVFQDGQFVPRLMLPLSLSYDHRVIDGADGVRF
VTHVSSLLADMRRVLL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagaacaaaccgtcgtcgtccccgatatcggcgacttcaaggacgtcgagatc
atcgaggtactggtcaagcctggcgacaaggtcgcggcgaacgactcgctgatcaccctg
gagagcgacaaggcggcgatggagattccttcgccctattccggcaccgtcaccgaactg
catgtgcgcgtcggcagcaaagtcagcatggggacgcccattctgcagctgcgggaggac
gagggcacggacgcctctggggcggcttccgccccggtagaaccggcgccggccgagcct
gtttccccgccaccggccgcagccgccccggctgcgggcgacacccaggcagtccctgcg
tcggcgcccacacctcctgcgccgatgccggtcgccgaggaaggctcgggaccggcccac
gccagccccgccgtacgtcgcttcgcccgcgaactcggcgtggacgtggcgaaagtccgc
ggcaccggcccgaaaggccgcatcctgaaaacggacgtccagtctttcgtgaaacaagcc
gtcgcgacagcagaacggacgggcggcggcggtttcgccgtgccggcgatgccagagatc
gatttcgcccagttcggcccgatcgaacgccagccgctgtcgcgaatccagaagctctct
tccgccaacctccaccgcacctggctcaccgtcccccacgtcacccagcatgacgaggcc
gacatcaccgagctggaagccttccgaaatgcgctcaaggccgaatccgccaagcgcggc
gtcaaactgaccctcctgccattcatcatcaaggctgcggtcgctgcgctgaaggacttc
ccgcgcttcaacgcgtcagtcgctcccaatggcgaggagctgatcctgaagcgctactac
cacgtgggttttgcggtggacacgccggacggcctggtggtgccggtgatccgcgacgcc
gacaccaaaggtatctgggacatcgccgccgaactcgccgccatcggcgacaaagcccgc
ggcaagaagctgcgcaccgccgatctgcagggcggcaccttcaccgtctccagcctggga
ggcatcggcggtatcgccttcaccccgatcatcaacgcccccgaggtcgccatcctgggt
gtctccaaggcgcagttgcgaccggtattccaagacggccagttcgtcccgcggctgatg
ctgcccttgtcgctgtcctacgatcaccgggtgatcgacggcgccgacggcgtccgcttc
gtcacccatgtcagcagcctgctcgccgacatgcggcgggtcctgctctaa

DBGET integrated database retrieval system