KEGG   Mycoplasma capricolum subsp. capripneumoniae 87001: MCCG_0038Help
Entry
MCCG_0038         CDS       T03705                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mcai  Mycoplasma capricolum subsp. capripneumoniae 87001
Pathway
mcai00450  Selenocompound metabolism
mcai00970  Aminoacyl-tRNA biosynthesis
mcai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MCCG_0038
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCCG_0038
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcai01007]
    MCCG_0038
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcai03016]
    MCCG_0038
Enzymes [BR:mcai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MCCG_0038
Amino acid related enzymes [BR:mcai01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MCCG_0038
Transfer RNA biogenesis [BR:mcai03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MCCG_0038
 Prokaryotic type
   Other AARSs
    MCCG_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AJK51044
UniProt: A0A1D5B3E3
Position
44521..46050
Genome map
AA seq 509 aa AA seqDB search
MSKKFYITTPIYYPSGNLHLGHAYTTTLADILNRYKKEQGYETFFLTGSDEHGQKIENKA
KEANLTPLEYLNPKVQAFKDLWTKLNIDYDKFIRTTDDYHQNTVQKIFTILLEKGYIYKG
QYEGIYCVSCEEFLTNEQIDENGLCKISSTKLQLVNEDTYFLKVSQFQEFVQNILKSDFL
IPEYRRNEMLKNFVEPGLKDLSVTRVSFKWGIPITQDEKHIIYVWLDALSNYITALGYLQ
KDDSLFKKFWQNDDCEILQLAGKEIIRFHSIYWPVMLEALNLKQPTHLLGHGWILNKNTK
MSKSLGNVIDPVKIIELYSADALRFYIANDLPTEKDGNFSLELFIESFNAHLANNVGNLI
SRTHNMISKYFNGYIDLNNVNYDQELIDLGIKTIDNYIFNMDQYKISEAIKVVLELSNAC
NKYIEVKTPWNLEKENKIEELKTVLSTLQRNIAIISYLLKPVLADSYNDMIEQCGLENVD
INFDNLKTFFNIKFNKLDNKKVIFNRIKD
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaaattttatataaccacaccaatttattatcctagtggtaatttacatcta
ggtcatgcttatacaacaacgctagctgatattttaaatagatataaaaaagaacaaggt
tatgaaactttctttttaacaggtagtgatgaacatggtcaaaagattgaaaacaaagca
aaagaagctaatttaacaccactagaatatctaaatcctaaagtacaagcttttaaagat
ttatgaactaaattaaatattgattatgataaattcattagaactacagatgattatcat
caaaatactgttcaaaagatctttactattttattagaaaaaggatatatctataaagga
caatatgaaggaatatattgtgttagttgtgaagagtttttaactaatgaacaaattgat
gaaaatggattatgtaaaatttcaagcacaaaactacaactagttaatgaagatacttac
tttttaaaagttagtcagtttcaagaatttgtgcaaaatattttaaaatcagacttttta
attcctgaatatagaagaaatgaaatgttaaaaaattttgttgaaccaggattaaaagat
ttatcagtaactagagtgagttttaagtgaggaattccgattactcaagatgaaaaacat
ataatttatgtttgattagatgctttaagtaactatataacagctttaggatatcttcaa
aaagacgactcattgtttaaaaagttttgacaaaatgatgattgtgaaattttacaatta
gctggaaaagaaattattaggtttcactcaatttattgaccagtaatgttagaagcttta
aatttaaaacaacctacacatttactaggtcacggatgaattttaaataaaaatactaaa
atgagtaaatctttaggaaatgtaattgatccagttaaaattattgaattatattcagct
gatgctttaagattttatatagcaaatgatctaccaactgaaaaagatggtaattttagt
cttgaattatttattgaatcatttaatgctcatctagctaataatgtaggtaatttaata
agtagaactcataacatgattagtaaatattttaatggatatattgatttaaataatgtt
aattatgatcaagaactaattgatttaggtatcaaaacaattgataactatatttttaat
atggatcaatataaaattagtgaagctattaaagtggttttagagttatctaatgcatgt
aataaatatattgaagttaaaacgccttgaaatttagaaaaagaaaacaaaattgaagaa
ttaaaaactgttttatctactttacaaagaaatattgcaatcatttcttatttattaaaa
ccagtattagctgactcatataatgatatgattgaacaatgtgggttagaaaatgttgat
attaattttgataatttaaaaacattttttaatattaaatttaataaattagataataaa
aaagttatatttaatagaattaaagattaa

DBGET integrated database retrieval system