KEGG   Macrococcus canis: MCCS_00220Help
Entry
MCCS_00220        CDS       T04838                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mcak  Macrococcus canis
Pathway
mcak00230  Purine metabolism
mcak00250  Alanine, aspartate and glutamate metabolism
mcak01100  Metabolic pathways
Module
mcak_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MCCS_00220 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MCCS_00220 (purA)
Enzymes [BR:mcak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     MCCS_00220 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ARQ05696
UniProt: A0A1W7A8G6
Position
23427..24716
Genome map
AA seq 429 aa AA seqDB search
MSSIVVVGTQWGDEGKGKITDFLAEEANVIARFSGGNNAGHTIKFGGETYKLHLVPSGIF
YSDKLSVIGNGVVVDPVALLKELDALNARGVKTDNLRISNRAQVILPYHIKQDGLEEDKR
GDNKIGTTKKGIGPAYVDKVQRIGIRMADLLDKETFEVKLKENLAMKNEMFEKLFDAEGF
KFEEIFDEYYAAGQRLKEYTVDTAKVLDDAFMADEKVLFEGAQGVMLDIDHGTYPFVTSS
NPIAGNVTVGTGVGPTFVDKVVGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTT
GRPRRVGWFDSVVLRHSRRASGITDLSINSIDVLTGLETVKICTAYELDGKEITEYPANL
NELNRCKPIFEELPGWTEDVTSCKSLDELPDNARRYLERISELCNVKISIFSVGPDRNQT
NLLENLWEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatcgtagttgttgggacgcaatggggagacgaaggtaagggtaagatcaca
gactttttagcagaggaagcaaatgttattgcacgtttctcagggggtaataacgcaggt
catacgattaagttcggtggagaaacatataaattacatctagtaccatcaggaatattc
tattctgataaattatctgtaattggtaatggtgtagttgtagatcctgtagctttatta
aaagaattagatgcactaaatgcacgtggtgtgaaaactgataacttacgtatttcaaac
cgtgcgcaagtcatccttccatatcatattaaacaagatggtcttgaagaagataaacgt
ggcgataataagattggtacaacgaaaaaaggtatcggacccgcttatgtagataaagta
caacgtattggtattcgcatggcagacttacttgataaagaaactttcgaagtaaaatta
aaagaaaatttagcgatgaaaaacgaaatgtttgaaaaattattcgatgctgaaggattt
aaatttgaagaaatctttgatgagtattatgctgcaggccaacgtctgaaagaatataca
gtggacacagcgaaagtgttagatgatgcatttatggcagatgaaaaagtactatttgaa
ggtgcacaaggagttatgcttgatatcgatcacggaacatacccattcgttacttcaagt
aatccaatcgctgggaacgtcacagttggtacaggtgtagggccaacatttgttgataaa
gtcgttggagtatgtaaagcttatacatcacgtgtaggcgatggacctttcccaactgaa
ttatttgatgaagatggtcatcacatccgtgaagtaggtcgtgaatatggaacgactaca
ggacgtccacgtcgtgtaggttggtttgactctgttgtattacgtcattcacgccgcgca
agtggtattacagatttatctattaactcaattgacgtattaacaggattagaaacagtg
aagatttgtacagcatacgaattagatggtaaagaaattacggaatatccagcgaattta
aatgaattgaatcgttgtaagccgattttcgaggaattaccaggatggactgaagatgtg
acttcatgtaaatcattagatgagttacctgataacgcacgtcgttacttagaacgtatc
tctgagttatgtaacgttaagatttctatcttctcagttggaccagatagaaaccagacg
aatctattagaaaacttgtgggaaaaataa

DBGET integrated database retrieval system