KEGG   Macrococcus canis: MCCS_03250Help
Entry
MCCS_03250        CDS       T04838                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mcak  Macrococcus canis
Pathway
mcak03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MCCS_03250 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mcak03011]
    MCCS_03250 (rplV)
Ribosome [BR:mcak03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MCCS_03250 (rplV)
  Bacteria
    MCCS_03250 (rplV)
  Archaea
    MCCS_03250 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ARQ05993
UniProt: A0A1W7A8L2
Position
306893..307267
Genome map
AA seq 124 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKEVAEAIAILKLTNKASSPIVEKLLMSALANAEH
NYDMNIDTLVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVADKEVKTSNTEAQ
EEAK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgcaagaacaatcagaatcgcacctcgtaaagtgagattagtt
ttagatcttatcagaggtaaagaagtagcggaagctatcgctattttaaaattaacaaac
aaagcatcatcaccaatagttgaaaagttattaatgtcagcattagcaaatgcagaacat
aactatgatatgaatatcgatactttagttgttaaagaagcttatgcaaatgaaggacca
actttaaaacgtttccgtccacgtgcacaaggtcgtgcaagtgcgatcaacaaacgtact
agccacatcactatcgttgtagctgacaaagaagttaaaacttcaaacactgaagctcaa
gaagaagcaaaataa

DBGET integrated database retrieval system