KEGG   Macrococcus canis: MCCS_13450Help
Entry
MCCS_13450        CDS       T04838                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mcak  Macrococcus canis
Pathway
mcak00030  Pentose phosphate pathway
mcak00480  Glutathione metabolism
mcak01100  Metabolic pathways
mcak01110  Biosynthesis of secondary metabolites
mcak01120  Microbial metabolism in diverse environments
mcak01130  Biosynthesis of antibiotics
mcak01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MCCS_13450 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MCCS_13450 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcak04147]
    MCCS_13450 (zwf)
Enzymes [BR:mcak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     MCCS_13450 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     MCCS_13450 (zwf)
Exosome [BR:mcak04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MCCS_13450 (zwf)
  Exosomal proteins of colorectal cancer cells
   MCCS_13450 (zwf)
  Exosomal proteins of bladder cancer cells
   MCCS_13450 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N RVT_2
Motif
Other DBs
NCBI-ProteinID: ARQ06987
UniProt: A0A1W7ABK0
Position
1282216..1283694
Genome map
AA seq 492 aa AA seqDB search
MDIEKQNIPCLITIFGATGDLSHRKLFPSLFHLFQQGNLNDQIAIIGIGRRAWSNDKFRA
EIRASIEKFVADTHKIDAFMEHVFYQPHDVNDAASYASLKSLSETLDAEFNLQGNRLFYL
AMAPEFFGTVTDHLKLSGLTKTDGFKRLIIEKPFGKDLKSAEQLNQQIRKSFKEEEIYRI
DHYLGKDMVQNIEVIRFSNAMFEPLWNNKYISNIQVTSSEILGVEDRGGYYDKSGALKDM
VQNHMLQIVSLLAMEPPISLSSEDIRNEKVKALRSIRKIKPEHVRSYFVRGQYDAGEING
EKVQKYRDEDNVAPDSNTPTFVAAKVMLDNFRWAGVPFYIRTGKRMKEKEIRVVVEFKEM
PMNLYYQKDKELDSNLLIINIQPNEGIELHLNARKYIEGIDTEPVKLSYAMTAQDKMNTV
DAYEGLIYDCLRGDATNFTHWEELKATWSYVDTVAEYWDNNPAPFPNYPAGSNGPIKSEL
LLSRDNFHWWDF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttggatatagaaaagcaaaatattccctgcttaattaccatttttggtgcaacaggcgac
ttaagtcatcgtaaattatttccatccctgttccatctttttcaacagggaaatctcaat
gaccaaattgcaatcatcggaattggccgacgtgcatggtcaaatgataaattcagagct
gaaatcagagcttctatcgagaagtttgtagctgatacgcataaaatcgacgcctttatg
gaacacgtattttatcagccgcatgatgtaaatgatgctgcaagctatgcatcgcttaaa
tcactttcagaaactttagatgctgaatttaacctgcaaggtaaccgcctattttattta
gcaatggctccagaattctttggtactgttaccgatcatttgaaattaagtggtcttact
aagacagatggtttcaaacgtctaataatcgaaaaaccatttggtaaggatttaaaatct
gcagagcagttaaatcagcagattcgaaaatcattcaaagaagaagaaatatatcgtatc
gatcattatcttggaaaagatatggtacaaaatattgaggtcattcgttttagcaatgcc
atgtttgaacctttatggaataataaatatatctcaaatattcaggtcacgtcatctgaa
attcttggtgttgaagatcgaggtggctattatgataagagcggcgctttaaaagatatg
gtacagaatcatatgctacaaatcgtttctctactggcaatggagcctccaatctccctg
tcatcagaagatattagaaacgaaaaggttaaagctttacgttctattcgcaagattaaa
cccgaacatgtcagaagctattttgttcgcggacagtatgatgctggtgaaattaatggt
gagaaggtacaaaaatatcgtgacgaagataatgtcgcaccagatagtaacactcccact
ttcgttgcagcaaaagttatgcttgataacttcagatgggctggcgttccattctatatc
agaaccggtaaacgtatgaaagaaaaagaaatcagagtagttgtagaattcaaagaaatg
ccgatgaacctatactatcagaaagataaagaactcgattcaaatctgctgatcatcaat
attcagccaaatgaaggaattgaactacatttaaatgcacgtaaatatatagaaggaatc
gatacagagcctgtaaagctttcttatgcgatgactgcacaagataagatgaacaccgtt
gatgcatatgaaggattaatctatgactgtttacgtggtgatgcaacaaacttcacccat
tgggaagaactgaaagcgacctggtcatatgttgatactgttgcggaatactgggataat
aatccagcaccattccctaactatccggcaggcagcaatggaccgattaagagcgaatta
ctgcttagtcgtgataatttccattggtgggatttctaa

DBGET integrated database retrieval system