KEGG   Mus caroli (Ryukyu mouse): 110284469Help
Entry
110284469         CDS       T05910                                 

Gene name
Crem
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110284469 (Crem)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110284469 (Crem)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110284469 (Crem)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 110284469
NCBI-ProteinID: XP_021005846
Ensembl: MGP_CAROLIEiJ_G0021964
Position
18
AA seq 357 aa AA seqDB search
MSKCGRKKYMRTNVRQMTMETVESQQDRSETRSVAEHNSAHMQTGQISVPTLAQVSVAGS
GTGRGSPAVTLVQLPSGQTVQVQGVIQTPHPSVIQSPQIQTVQVATIAETDDSADSEVID
SHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTG
QYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS
QVVVQDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATR
KRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaagtatatgaggacaaatgtaaggcaaatgaccatggaa
acagttgaatcacagcaggatcgaagtgaaacacgttctgtggcagagcataactctgct
catatgcaaactggtcaaatttctgttcctactctagctcaggtttctgtagctggatca
ggcactggaagaggctccccagctgtgactctagtacagttaccttcaggccaaactgta
caggtccagggagtaattcagacaccacatccatcggttattcaatcaccacaaatacaa
actgttcaggtagcaacaattgcagagacagatgattctgcagactcagaagtaatcgat
tcgcataaacgtagagaaattctttcacgaagaccctcatatagaaaaatactgaatgaa
ctttcctctgatgtgcctggtattcccaagattgaagaagaaaaatcagaggaagaaggg
acaccacctaacattgctaccatggcagtaccaactagcatatatcagactagcacgggg
caatacattgctatagctcaaggtggaacaatccagatttctaacccaggatctgatggt
gttcagggactccaggcattaacaatgacaaattcaggagctcctccgccaggtgctaca
attgtacagtatgcagcacaatcagccgatggtacacagcagttctttgtcccaggcagc
caggttgttgttcaagatgaggagactgaccttgccccaagtcacatggctgctgccaca
ggtgacatgccaacttaccagatccgagctcctactaccgctttgccacaaggtgtggtg
atggctgcctcaccaggaagcctgcacagtccccagcaactagcagaagaagcaactcgc
aagcgggagctgaggctgatgaaaaacagggaagctgctaaagaatgtcgacgtcgaaag
aaagagtatgtgaagtgtcttgagagtcgagtcgcagtgctggaagttcagaacaagaag
cttatagaggagcttgaaactttgaaagacatttgctctcccaaaacagattag

DBGET integrated database retrieval system