KEGG   Mus caroli (Ryukyu mouse): 110285272Help
Entry
110285272         CDS       T05910                                 

Gene name
Dock8
Definition
(RefSeq) dedicator of cytokinesis protein 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110285272 (Dock8)
Membrane trafficking [BR:mcal04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110285272 (Dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 110285272
NCBI-ProteinID: XP_021006958
Ensembl: MGP_CAROLIEiJ_G0022836
Position
19
AA seq 2100 aa AA seqDB search
MATLPSAERRAFALKINRYSSSEIRKQFTLPPNLGQYHRHSISTSGFPSLQLPQLYEPVE
PVDFEGLVMTHLNSLDAELAQELGDLTDDDLHVAFTPKECRTLQHSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSSEFCSFKKTGSRRDFQKSLQKQTFESETLECSEPDTQTGPR
RPLNVLCDVSGKGPLTSCDFDLRSLQPDERLENLLQLVSAEDFEKEKEEARKTNRPAELF
ALYPPVDEEDAVEIRPVPECPKEHLGNRILVKVLTLKFEIEIEPLFASIALYDVKERKKI
SENFHCDLNSDQFKGFLRAHTPSIDPSSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIA
DCAEPYMIIKESDGGKSKEKVEKLKLQAESFCQRLGKYRMPFAWAPISLASFFNVSTLER
ESTDVEPGVGRNPVGEKRSLSQSRRPSERTLSLEENGVGSNFKATTLATNIFFKQEGDRL
SDEDLFKFLADYKRSSSLQRRVKSIPGSLRLEISPAPDVMNCCLTPEMLPVKPFPENRTR
PHKEILEFPIREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDPSNAMP
VIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQG
ASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHK
GVFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVSFPIRVLDQKITESTLEHELKLSIIC
LNSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLRK
DQHGRNCLLASYVHYVFRLPELHRDAPKSGGPTTVVPDPRYHTYGRTSAAAVSSKLMQAR
VMSSSNPDLTGTHCAADEEVKNIMSSKIADRNCSRMSYYCSGNSDAPGSTAAPRPVSKKH
FHEELALQMVVSTGVVRETVFKYAWFFFELLVKSMAQYVHNLDKRDSFRRTRFSDRFKDD
ITTIVNVVTSEIAALLVKPQKESEQAEKINISLAFFLYDLLSIMDRGFVFNLIKHYCSQL
SAKLNILPTLISMRLEFLRILCSHEHYLNLNLLFMNTDTAPASPCPSISSQNSSSCSSFQ
DQKIASMFDLTPEYRQQHFLTGLLFTELAVALDAEGDGISRVQRKAVSAIHSLLCSHDLD
PRCLKPEVKVKIAALYLPLVGIILDALPQLYDFTDARSGRSRASGSYEEQDVANGINQNV
ALAIAGNHFNLKTSGAMLSSLPYKQYNMLNADTTRHLMICFLWIMKNADQSLIRKWIADL
PSMQLNRILDLLFICVSCFEYKGKQSSDKVSNQVLQKSRDVKAKLEEALLRGEGARGEMM
RRRIPGTDRFPGINENLRWRKEQTQWRQANEKLDKTKAELDQEALISGNLATEANLIILD
MQENIIQASSALDCKDSLLGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFEE
EMEQCADLCQRVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMALASLV
GKAPDFNEEHLRRSLRTILAYSEEDTAMQTTPFPMQVEELLCNLNSILYDTVKMREFQED
PEMLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSML
EDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELF
STGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINKDHKRMFGTYFRVGF
YGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPN
KAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVL
TTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQG
SVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQ
REYQQELKKNYNKLRDSLRPMIERKIPELYKPIFRVDSQKRDSFHRSSFRKCETQLSQGS
NT seq 6303 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgccgagcgctgagcgccgcgccttcgcgctcaagatcaacaggtattca
tcgtcagaaataaggaagcagtttacactcccgcccaacctcggacagtaccatcggcac
agtatcagtacatctggtttcccctctcttcagctacctcagctttatgagcccgtcgag
ccagtggactttgaaggactcgtgatgacacacttaaacagcttggatgcagagctggcc
caggagctgggggacctcactgatgacgacctgcatgtggccttcacacccaaagaatgt
aggactttgcagcactctctgccagaggaaggagttgaactggatcctcacgtcagagac
tgtgttcagacctatattcgagagtggctgattgtgaaccggaaaaaccaaggaagttca
gagttttgcagctttaaaaagactggatctcgcagagattttcagaagtcgcttcagaag
cagacgtttgagtcagaaaccttggagtgcagtgaaccggacactcagacaggaccccgt
cgtcccttaaacgtgctgtgtgacgtgtctgggaagggccccctcacttcttgtgacttc
gacctccgcagcctgcagcctgatgagcggctggaaaacctgctccagcttgtgagcgct
gaggactttgagaaggagaaggaggaggcccgcaagaccaatcggccggctgagctcttc
gccctctatccgcccgtggatgaggaggatgctgtggaaatacgtccagtacctgaatgt
cctaaggaacatctgggcaacagaatattggtcaaggtgctgactctgaagtttgagatc
gaaattgagcctctgtttgccagtattgccctctatgacgttaaagaaaggaaaaagatc
tcagaaaatttccactgtgacctgaactccgaccagttcaaagggtttctgcgagctcac
acaccctcgattgacccatcgagtcaggctaggtctgccgtgttctccgtcacctaccca
tcttcagacatctacctggttgtcaagattgaaaaagtccttcagcaaggagagattgca
gactgtgcagaaccctacatgatcatcaaagaaagcgatggtggaaagagtaaagaaaag
gttgaaaaactaaaacttcaagctgaatccttctgccaacgtttggggaaataccggatg
cccttcgcctgggcccccattagcttagcaagcttcttcaacgtctccacccttgaaagg
gagagcacagatgtggagcctggggttgggagaaaccctgtgggtgagaagaggagcttg
tcccaatccaggaggccctctgagcgaaccctctccttagaggaaaatggagttggatcc
aacttcaaagccaccaccttggccaccaacatcttcttcaaacaggagggagatcgcctg
agtgatgaagacttgttcaagtttttagctgactacaagagatcttcatctctacagcga
agagtcaaatccattccaggctcactgaggctggagatatccccagctcccgacgtgatg
aactgctgcctgacacctgagatgttgccagtcaaaccttttcctgaaaatcggacgcgt
ccacacaaggagattttggaatttccgatccgggaagtgtacgtccctcacactgtgtac
agaaaccttctgtatgtatacccccagagactgaacttcgctaataagctagcatctgcc
cggaacatcacaataaagattcagtttatgtgcggagaagaccccagcaatgctatgcca
gtcatctttggcaagtccagtgggcctgaatttctgcaggaagtatatacagctattaca
taccataataagtctcctgacttttacgaagaagtgaaaattaagctccccgccaagctc
acggtgaatcaccatctcctcttcaccttctaccacatcagctgtcagcagaagcaaggg
gcctccggagaaagccttctgggctactcgtggctgccgattctcttaaacgaacgtctt
caaaccggatcctactgtctgcccgttgccttggaaaaactaccacccaactactccata
cattctgctgagaaagtccctttacagaatccccccattaagtgggccgagggccataag
ggggtatttaatatcgaagtgcaagctgtttcttccgttcacacccaggataaccacctg
gagaagttcttcaccctttgccactccctggagagccaggtgagcttccctattcgagtg
ctggaccagaagatcaccgagagcacgctggagcacgagctgaaactcagcatcatctgc
ctcaactcctcccgcctggagcccctcgtgctcttcctccacctggtgctcgacaagctg
ttccagctttccgtgcagcccatggtcattgctggccaaacagcaaacttctcccagttt
gccttcgagtctgtggtggccattgccaatagcctgcacaacagcaaggacctgaggaag
gaccaacacgggaggaactgccttctggcctcctacgtgcactacgtgttccggctgcca
gaactgcacagggatgcaccaaagtcaggtggccccaccaccgtagtccccgacccccga
taccacacatatggacgcacatctgccgctgcagtgagttcaaagctgatgcaggcccgt
gtgatgagcagcagcaacccagacctgactgggacacactgtgcagccgatgaggaagtt
aagaacatcatgtcttcaaagattgccgatcgcaactgcagccggatgtcttactattgc
tccggcaatagtgatgcgccaggttcaactgcagccccaagaccagtcagcaaaaagcat
ttccatgaggagcttgccctgcagatggtggtcagcactggagtagtgagagaaacggtc
ttcaagtacgcctggttcttctttgagcttctggtgaaaagcatggcacagtatgtccat
aacctggataaacgggacagttttcggaggactcgcttttctgaccgcttcaaagatgac
ataactaccattgttaatgtggtcacctcggagatagcagcccttttagtgaaacctcag
aaggaaagcgagcaggcagaaaagatcaacatcagcctggccttcttcctgtatgacctc
ctgtcaatcatggacagaggcttcgtgttcaacctcatcaagcattactgcagccagctg
tcagccaagctgaatatccttccaacgctcatctccatgcggcttgaattcctgaggatc
ctctgcagccatgagcactacctcaacttgaacctcctcttcatgaataccgacaccgca
ccagcatctccctgcccctccatatcctcccagaactcaagctcctgctccagtttccag
gaccaaaagattgccagcatgttcgatctgaccccggagtaccggcagcagcacttcctc
acagggctgctcttcacggagctggctgtcgccctggatgctgaaggggatggaattagc
agagtacagagaaaagccgtgagtgccatccacagccttctgtgctctcacgacctggat
ccacggtgtctcaaaccggaagtgaaagtcaaaatcgccgccctttacctgccgttggtc
ggcatcattctggacgctctgccacagctctatgactttacagatgctcgcagtggaagg
agtcgtgccagtggttcgtatgaagaacaagatgtggccaatggaatcaaccagaatgtg
gccctggccatagcagggaatcactttaatttgaagaccagtggagcaatgctgtcttcc
ttgccctataagcagtacaacatgctgaatgcagacaccacccgccacctcatgatttgc
ttcctgtggatcatgaaaaatgctgatcagagcctcatcaggaagtggatcgctgacctg
ccttccatgcagctcaataggattctggacctgctgttcatctgtgtctcctgctttgaa
tacaagggaaagcagagttctgacaaagtcagtaaccaggtcctgcagaagtcaagagac
gtcaaggccaagctggaagaggctctgctccgtggggaaggagcccgtggggagatgatg
cgccgtcgcattccagggactgaccggtttccaggcatcaatgaaaatctgagatggagg
aaagagcagacacagtggcggcaggctaatgagaagctggacaaaacaaaggctgagtta
gatcaagaagccttgatcagtggcaacctggctacagaagctaatttgatcatcctggat
atgcaggagaacatcatccaggcaagctccgccctggactgtaaagacagcctgctggga
ggtgtcctccgggtcctggtgaattctctgagctgtgaccagagcaccacctacctgact
cactgtttcgcaaccctccgagccctcatcgccaagtttggagacctgctgttcgaggag
gagatggagcagtgtgctgacctgtgtcagcgggtgctacatcactgcagcagcagcatg
gacgtcacacggagccaagcctgtgccaccctctacctcctcatgcggttcagcttcgga
gccaccagtaactttgcaagagtaaagatgcaagtgaccatggcactggcatccctggta
ggcaaagcaccagacttcaatgaagagcacctgagaaggtccttaaggacaattttggcc
tattcagaagaggacacggccatgcaaacaactccttttcccatgcaggtggaggaactt
ctctgcaatctgaacagcattctgtatgacacagtgaagatgagggaattccaggaagac
cctgagatgcttatggacctcatgtacagaattgccaagagctaccaggcatcgcctgac
ctgcggctgacctggctccagaacatggcagagaaacacactaagaagaagtgcttcacg
gaggccgccatgtgcctggtgcatgcagccgccctggtggctgagtacctgagcatgctg
gaggaccacagctacctgccagtgggcagcgtcagctttcagaatatttcttccaatgtg
cttgaggagtctgcagtctctgatgacaccttgtcacctgatgaggacggcgtgtgctct
gggcggtacttcaccgagagtggcctggtgggcctcctggagcaggctgcggagctcttc
agcacgggaggcttgtacgagacagttaatgaagtctacaagctggtcatccctatcctg
gaggcacacagagatttccggaagctgacctccactcacgacaagctgcagaaggccttc
gacaacatcatcaacaaggaccacaagaggatgtttggaacctacttccgagttggtttc
tacggatcccgatttggggatttggatgagcaggagttcgtgtacaaggagcccgcaatc
acgaagctcccggagatctcacatagactagagggattttatggccagtgtttcggtgca
gagtttgtggaagtgataaaagactctactcctgtggataaaaccaagttggatcctaat
aaggcctacatccaaatcacttttgtggagccttactttgatgaatatgagatgaaagac
cgggtgacctacttcgagaagaatttcaacctccggaggttcatgtacaccacccccttc
accctggaggggagaccccggggcgagcttcatgagcaacaccgcagaaacaccgtgctc
accaccatgcacgccttcccctacatcaagaccaggatccgagtcagccagaaagaggag
ttcgttttgactccgattgaggttgccattgaagatatgaagaagaagaccctgcagtta
gccgtggccactcaccaagagccccctgatgcgaagatgctgcagatggtactgcagggc
tctgtaggagccactgtaaatcagggaccactggaggtggcccaagtgttcttggctgaa
attccagctgacccaaagctctaccgacatcacaacaagctgaggttgtgcttcaaggag
ttcataatgcgatgtggagaggccgtggagaagaacaggcgactcatcaccgcagagcag
cgggagtaccagcaggagctgaagaagaactacaacaagctgagagacagcctcaggccc
atgattgagcggaaaatcccagagctctacaagcccatattcagagttgacagtcagaag
agggactctttccacagatctagtttcaggaaatgtgaaacccagttgtcacagggcagc
tga

DBGET integrated database retrieval system