KEGG   Mus caroli (Ryukyu mouse): 110285586
Entry
110285586         CDS       T05910                                 

Gene name
Acy3
Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110285586 (Acy3)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     110285586 (Acy3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 110285586
NCBI-ProteinID: XP_021007513
Ensembl: MGP_CAROLIEiJ_G0022479
Position
19
AA seq 319 aa
MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPSFSAMPVLANPAATAA
CCRYLDCDLNRTCTLTFLGSTATPDDPYEVKRARELNQLLGPKGTGQAFDFTLDLHNTTA
NTGVCLISEASHNSFNLHLCHYLQRQNPGMPCRLFQYEPAGTETFSVESISKNGICLEIG
PQPQGVLRADLFSQMRALVASILDFIELFNQGMDFPAFEMDIYRNLGSVDFPRTTDGDLA
GTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSTVYPVFINEAAYYEKHVAFLKSEK
IRVSVPTLLELTPRSTQTP
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtcctccctgcctgggtcccgggagcccctgctccgcgtggctgtgactggaggcacc
cacgggaatgagatgtgtggcgtctacctggctcggtactggctacagaacccaggggag
ctacagagacccagcttctcagccatgccggttctggccaacccagcagccacagccgcc
tgttgccgttacctggactgtgatctcaaccgcacctgcaccctcaccttccttggttcc
accgctacccccgatgacccgtacgaagtgaaaagagcccgagagttgaaccagctgctg
ggtcccaagggcacaggccaggcttttgactttaccctagacctgcacaacaccacagca
aacactggagtctgcctcatctctgaagcctcccacaactccttcaacttgcacctgtgc
cactacctacagcggcagaacccggggatgccctgccgcctctttcagtatgagccagct
gggacggagaccttcagcgtggaatctatatccaagaatggaatctgtctggagataggc
ccacagcctcagggcgtgctgcgggccgacctgttctcccagatgcgagctctggtggcg
tccattctagacttcattgagctcttcaaccaaggcatggacttccccgcctttgagatg
gatatctacaggaacttgggcagtgtggacttcccacgcaccacagatggtgacctggct
ggcactgtgcaccctcaactgcaggaccatgactttgagccactgaggcctggtgaaccc
atcttcaagctgttcagcggagaagacgtactgtatgagggggactccactgtgtaccct
gtgttcattaatgaggctgcctactatgagaagcacgtggctttcctgaagtctgagaag
atccgagtctcagtgcctaccctgctggagttgaccccccgctccacccagactccctaa

DBGET integrated database retrieval system