KEGG   Mus caroli (Ryukyu mouse): 110286943Help
Entry
110286943         CDS       T05910                                 

Gene name
Pnck
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1B
  KO
K08795  pregnancy upregulated non-ubiquitously expressed CaM kinase [EC:2.7.11.17]
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110286943 (Pnck)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110286943 (Pnck)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   110286943 (Pnck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 110286943
NCBI-ProteinID: XP_021009287
Ensembl: MGP_CAROLIEiJ_G0033154
Position
X
AA seq 343 aa AA seqDB search
MLLLKKQTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVEN
EIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQV
LGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVA
PELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS
ESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDRDILGSVSEQIQKNFARTHWKRA
FNATSFLRHIRKLGQSPEGEEASRQCMTRHSHPGLGTSQSPKW
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctcaagaaacagacggaggacatcagcagtgtctatgagatccgggagaag
ctgggctcgggtgccttctctgaggtgatgctggcccaggaaaggggctctgctcatctt
gtggccctcaagtgcattcccaagaaagcacttcggggcaaggaggccctggtggagaat
gagatcgcggtactccgcagaatcagccatcccaacattgtggctctggaggacgtccat
gagagtccttcccatctctacttggccatggagctggtaacaggtggtgaactgtttgac
cgcatcatggagcggggctcctacacagagaaggacgccagccatcttgtagggcaggtc
cttggcgctgtctcctaccttcatagcctgggcatcgtgcaccgggacctcaagcctgaa
aacctcctctatgccacaccttttgaggactccaagatcatggtctctgactttggcctg
tccaaaatacaagctggcaacatgctaggcacagcctgtgggaccccaggatatgtggcc
ccagagctcctggagcagaaaccctacgggaaggccgtagatgtgtgggccctgggtgtc
atctcctacatcctgctgtgtgggtatccccccttctatgatgagagcgatcctgaactc
ttcagccagattctgagggccagctatgagtttgactcccccttttgggatgacatctca
gaatcagccaaagacttcattcgccaccttctggaacgtgatccccagaagaggttcacc
tgccaacaggccctacagcatctttggatctctggggatgcagccttcgatagggacatc
ctgggttctgtcagtgagcagatccagaagaattttgccaggacccactggaagcgtgca
ttcaatgccacatcattcctacgtcacatccgtaagctgggacaaagcccagagggtgag
gaggcctccaggcagtgtatgacccgtcatagccacccaggccttgggactagccagtcc
cccaagtggtga

DBGET integrated database retrieval system