KEGG   Mus caroli (Ryukyu mouse): 110287400
Entry
110287400         CDS       T05910                                 

Gene name
Apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04080  Neuroactive ligand-receptor interaction
mcal04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110287400 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110287400 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 110287400
NCBI-ProteinID: XP_021009692
Ensembl: MGP_CAROLIEiJ_G0033036
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgaggctctgcgtgcaggcgctgctgctgctctggctctccttgactgcagtt
tgtggagtgccactgatgttgcctccagatggaacagggctagaagaaggcagcatgcgc
tacctggtgaagcccagaacttcgaggactggaccaggagcctggcagggaggcaggagg
aaatttcgcagacagcgcccccggctctcccataagggccccatgcctttctaa

DBGET integrated database retrieval system