KEGG   Mus caroli (Ryukyu mouse): 110288846Help
Entry
110288846         CDS       T05910                                 

Definition
(RefSeq) mast cell protease 2
  KO
K01329  chymase [EC:3.4.21.39]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    110288846
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcal01002]
    110288846
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     110288846
Peptidases [BR:mcal01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110288846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 110288846
NCBI-ProteinID: XP_021010740
Position
Unknown
AA seq 243 aa AA seqDB search
MRALLFLMALLLPSGAGAEEIIDGVEAKPHSLPYMAHLRIITNNGLKRCGGFLIAPQFVM
TAAHCSGRDITVILGAHNINKNESTQQIIKAEKQFVHPKFRYSSGFNDIMLLKLQKKAEL
TSAVNVISLPSSSDFIKPGKMCWTAGWGKTGKNNPPSVTLREVELRIMDQEACKDHSDYD
YQLQVCSGSPTTSKSIGQGDSGGPLVCDGMAHGIASSSEAKAPAVFTRISSYLPWIYKVL
KGE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccctgctattcctcatggcacttctcttgccttctggggctggagctgaggag
attattgatggtgttgaggctaaaccacactcccttccttacatggcccatctgaggatc
atcactaacaatggtttgaagaggtgtggtgggtttctcatagccccgcaatttgtgatg
actgctgcacactgtagtggaagagacatcactgtcatccttggagctcataatataaac
aagaacgaatccacacagcagataataaaagctgaaaaacaatttgttcacccaaagttt
cgttactcttcgggtttcaatgacatcatgttactgaagctacaaaagaaagcagagttg
acttctgctgtgaatgtaatttcactgcctagttcctctgactttatcaagcctgggaag
atgtgctggacagctggatgggggaaaactggcaagaataaccctccatcagttaccctg
agagaggttgaactgagaatcatggatcaagaggcctgtaaagaccacagtgattatgat
tatcaactccaggtctgctcgggcagtcccacaacatcgaaatcaataggacaaggagat
tctgggggacctctagtgtgtgatggtatggcccatggtattgcatcttcttcagaagca
aaggcccctgcagtcttcacccgaatctcctcatacctgccctggatatataaagtctta
aagggcgagtag

DBGET integrated database retrieval system