KEGG   Mus caroli (Ryukyu mouse): 110291357Help
Entry
110291357         CDS       T05910                                 

Gene name
Tyw3
Definition
(RefSeq) tRNA wybutosine-synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcal03016]
    110291357 (Tyw3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     110291357 (Tyw3)
Transfer RNA biogenesis [BR:mcal03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    110291357 (Tyw3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 RRXRR
Motif
Other DBs
NCBI-GeneID: 110291357
NCBI-ProteinID: XP_021014129
Ensembl: MGP_CAROLIEiJ_G0025755
Position
3
AA seq 257 aa AA seqDB search
MDRSAEFGRWKAQSLSKADLSRKGSVDEDAVEVVELLNSREEFFTTSSCAGRILLLDGSA
EGSGVQKQHCCWLLVTHKPCARDDVMAALKGATSEAVLKFEPFILHVQCRTLQDAQTLHS
VAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLTHKGKLMVTEEYIEFLLTIANQKMEE
NKRRIGRFYNCLQHAVKRETISNSHSKIKERNNPLCTHKNRQSQGKAQSPSTTEDNGREL
EDGDGLEISAALFLGDD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcagcgcggagttcggccggtggaaggcgcagagtctgagcaaggcggacctt
agccgcaagggcagcgtggacgaggacgcggtggaggtggtggagctcctgaactcgcgg
gaagagtttttcaccaccagctcctgcgcagggcgcatcctccttctggacgggagcgca
gaaggctctggagttcagaagcaacactgctgctggctgctggtcacacacaaaccgtgt
gcaagagacgatgtgatggcagctctgaagggtgcaaccagcgaagctgttttgaagttt
gaaccttttatcctccatgtgcaatgccggaccctgcaggacgcacaaaccctgcactca
gtggcaattgattctggcttcaggaactctggcatcaccgtgggaaagcgagggaagacc
atgctggctgtgcggagtacacatggattggaagtcccattaacccacaagggaaagctg
atggtaacagaggagtatatcgagttcctgttaaccatagcaaatcagaaaatggaggaa
aacaagagaagaattgggaggttttataactgcctacaacatgctgtcaaacgagaaacc
atttcaaactcacattccaagatcaaagagagaaataacccactttgtactcataagaat
aggcagagccaaggaaaagcacagagcccatcgaccactgaagacaacgggagggagcta
gaagacggtgatggcctggaaatcagtgctgcactcttcctgggagacgactga

DBGET integrated database retrieval system