KEGG   Mus caroli (Ryukyu mouse): 110292869
Entry
110292869         CDS       T05910                                 

Gene name
Aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcal03021]
    110292869 (Aff3)
Transcription machinery [BR:mcal03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     110292869 (Aff3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 110292869
NCBI-ProteinID: XP_021016169
Ensembl: MGP_CAROLIEiJ_G0014063
Position
1
AA seq 1255 aa
MDSFDLALLQEWDLESLWGEDILSQRNDSLVLEVQASASRCRSVYEPDRNALRRKERERR
SQETQQDSGSFNSGYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFGAESRAQSQPSSVCSTASSTPAAVPVQQGKRGTMSWQKAGHPP
SDGQQRAAQQGSLRTLLGDGVGRQQTRAKQVCNMEAGLQTQERPPAMAAKHGGSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETAVHCTAYRGVPANKPESA
RAKAKLAKFSIPKQAAESRSGESNSCVEEIIREMTWLPPLSAIQAPAKVEPSKFPFPNKD
SQLVSSGHSNPKKADAEPESPDNGASNTSTLEDDLKLSSDDEEGEQQAAQRTALRTLADS
SVVQQTNCRSSAPSSKGGSSSSSGGSSSSSDSESTSGSDSETESSSSESESEGSKPPHCS
SPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPERNQYYTPPVKDEGQDCGKLPEI
CQASLRDKELKTTCKEEQRPRTANKAPGSKSVKQKSPPAAVAVTAAALPPAVPSAPTESA
PAPTRRSAGKKPTRRTERTSAGDGANCHRPEEPVAPDTLGASVVGPLEPPKTRPCGNNRT
GHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYVLSKAAT
TTGSEQRLKEAASSSSSSSNSSSSSTSRASVGSINARTTSDIAKELEEQFYTLVPFGRNE
LLSPLKDSDEVRSLWVKIDLTLLSRIPEHLSQEPGVLSAPSAKDTDSAPASHALDTPAEK
TLPKSKRKRKCDNEDDYREIKKVQGRKESASRLAASTNNALSGNHCNVNVNSLAIPINKN
EKMLRSPTSPLSDTCKHKYASEDLTSSSRPHGNGLLTSASSNKEPKAESQLQTLAGDLTK
ASHNSSENGTLHSKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMREAKRMKHKA
DAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGP
NATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGSSG
KSTGSPSPMSPNPSPASSVGSQGSLSSSSGLSPSTIVSIPQRIHQMAANHVSITNSILHS
YDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRSSVHLS
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gatatcctaagccagaggaatgattctctagttctggaagttcaggcatcagccagcaga
tgcaggagtgtctatgaaccggacaggaatgcgttacggaggaaagagcgagaaagaaga
agtcaagaaacacagcaggacagtggcagctttaactccggttactcgctcttcagcgaa
ccctacaagactaacaagggggatgaactctccaaccggatccagaatacattaggaaat
tatgacgagatgaaagactttttaactgatagatccaaccagagtcatcttgttggtgtc
cccaagccaggtgtccctcagactcctgtgaacaagatagatgaacattttggggcagag
tcaagagcccagtcccagccctcatccgtctgcagcactgcgtcctctacacctgcagct
gtccctgtgcagcagggcaagagaggcaccatgagctggcagaaggctgggcacccacct
tccgatggccaacagagagcagcgcaacagggctctctcaggaccttgcttggagatggt
gttggcagacagcagacaagggccaagcaagtgtgcaatatggaggcggggcttcagacc
caggagaggccacctgcaatggcagccaagcacggcggcagtggacactgtgttcagaac
tttcccccatccctggcttcaaaacccagcctggtgcagcagaaaccaactgcctacgtg
cggccaatggatggccaggaccaggctcctgacgaatcacctaagctgaagtcttccaca
gaaactgctgtgcactgcacagcctacagaggggtcccggccaacaaaccagagtcagcc
cgagccaaagccaagcttgccaagttcagcatccccaagcaggcagcggagagtagatct
ggagaaagcaacagctgtgtggaagaaataattcgggagatgacctggcttcctccactt
tctgctattcaagctcctgccaaagtggaaccaagcaagttcccattcccaaataaggac
tcgcaacttgtatcctctggacacagtaatccaaagaaagctgatgcggagccagagagt
ccagacaatggcgcgtcgaacacttcaactctggaagacgaccttaagctaagcagtgat
gacgaagagggtgagcagcaggcagcccagagaacagctctccgcactctagctgacagc
tccgtggttcagcagaccaactgtagaagttcggcgccatccagcaagggcggcagcagc
agcagcagcggcggcagcagctcctccagcgactcagagagcacttccggctccgactcc
gagacggagagcagctccagcgagagcgagagcgagggcagcaagcctccgcactgctcc
agccccgaggccgaacctgcgtcctctaacaagtggcagctggataaatggctaaacaaa
gttaatcctcacaagccgccaattctgatccaaaatgaaagccacggcccggaaaggaat
caatactacacgccgccggtgaaagatgaagggcaagactgcgggaaacttcccgagatc
tgccaagccagcctgagggacaaggagctcaagaccacctgcaaggaggagcagcggcct
aggaccgcaaacaaggcccctggcagcaaaagtgtaaagcagaagtccccacccgctgct
gtggctgtgaccgcagctgccctcccacccgcggtgcccagcgcacccacggagagcgcg
cctgcgcccacccgcaggtcagcaggcaagaagcccacccggcgcaccgagaggacctca
gccggggatggtgccaactgccaccggcctgaggagccagtggccccagacacgctgggg
gcgagcgtggtgggacccctagagccccccaaaaccagaccctgtggtaacaacaggaca
ggccaccgcaaggagctgcgctcctccgtgacctgtgagaagcggcgcacgagggggctg
agcagaatcgtccccaaatccaaggagtttattgaaacagaatcttcgtcttcctcttcc
tcctcggactcagacctggagtcagagcaagaggagtacgtactgtccaaggctgcgacc
accactggaagcgagcagcggctgaaggaggccgccagcagcagcagcagcagcagcaac
agcagcagcagcagcacctcccgggcttctgtgggctccatcaatgccaggaccaccagt
gacattgccaaggagctagaggaacagttctacacgctggtcccctttggcaggaatgaa
ctgctatctccgctaaaggacagcgatgaggtcaggtctctctgggtcaaaattgacttg
accctcctgtccaggatcccagaacacctgtcccaggagcctggggtcttgagtgctcct
tcggccaaggacactgatagtgccccagccagtcatgcattagacacacctgctgaaaag
actttgccaaaatccaagaggaaacgcaagtgcgacaatgaagatgactacagggagata
aagaaggtccagggaaggaaggagagcgcctcacgtctcgccgcctccactaataacgcc
ttgtccggcaatcactgcaatgtgaacgtcaacagcttggcaataccaataaacaaaaat
gaaaagatgctccggtcgcccacttcgccactctcagacacatgtaaacacaaatacgcc
agcgaggacctgacttcttccagccgacctcacggcaacgggttgttgacttcagcgtct
tccaacaaagagcctaaggctgagagtcagctgcagacacttgctggggacctcacgaag
gcatctcacaacagttctgaaaatggcaccctccatagcaagtcacggccccagacggag
ccgtggtctccaggttccaatggccacagggactgcaaaagacagaaactgatcttcgat
gacatgcctcgaagtgcagattattttatgcgagaagccaagcggatgaaacataaagca
gacgccatggtggagaagttcgggaaggccctgaactatgccgaagctgccttgtccttc
atcgagtgcggaaacgcaatggaacaagggccaatggaatccaagtctccgtacaccatg
tactcggagacagtggagctcatcaggtatgctatgagactaaaaacccactcaggcccc
aatgccacaccagaggacaaacagttagctgcgctttgttaccgatgcctggctctccta
tactggcggatgtttcgactcaaaagagaccatgctgtaaaatattcaaaagcacttatc
gactatttcaagaattcatcgaaagctgcccaagccccatccccatgggggtccagtggc
aagagcactggaagcccatcccccatgtctcccaacccttctcccgccagctccgtgggg
tctcagggcagcctctccagctccagcggcctgtccccatcgaccatcgtcagcatcccc
cagcgcattcaccagatggcggccaatcacgtcagcatcaccaacagcatcctccacagc
tatgactactgggagatggctgataacctggccaaggaaaacagagagttcttcaatgac
ctggatttgctcatgggacctgtcaccctgcacagcagcatggaacacctggtccagtac
tcccagcaaggcctgcattggcttcggagcagcgtacacctgtcctag

DBGET integrated database retrieval system