KEGG   Mus caroli (Ryukyu mouse): 110293075Help
Entry
110293075         CDS       T05910                                 

Gene name
Rassf5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04218  Cellular senescence
mcal04670  Leukocyte transendothelial migration
mcal05200  Pathways in cancer
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110293075 (Rassf5)
   04015 Rap1 signaling pathway
    110293075 (Rassf5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110293075 (Rassf5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110293075 (Rassf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293075 (Rassf5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110293075 (Rassf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 Mst1_SARAH PHD
Motif
Other DBs
NCBI-GeneID: 110293075
NCBI-ProteinID: XP_021016507
Ensembl: MGP_CAROLIEiJ_G0014569
Position
1
AA seq 413 aa AA seqDB search
MASPAIGQRPYPLLLDPEPPRYLQNLGGTEPPPPARPRRCIPTALIPAARESEVRGGRRS
GRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRF
VELALRGGPGWCDLCGREVLRQALRCANCKFTCHPECRSLIQLDCRQKGGPALDRRSPES
TLTPTLNQNVCKAVEEKQHLPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLK
LRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGL
LKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETG
EVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccggccatcgggcagcgtccctacccgctgctcctagaccccgagccgccg
cggtatctgcagaatctgggtggcaccgagccgccacctcccgcccggccgcgccgctgc
atccccacggccctgatccccgcggccagggagtcagaggttcgcggtggcaggaggagt
ggccggagggaccccgagcccacaccccgggactgccgacacgctcgccctgtccggccc
ggtctgcagcctagactgcggctgcgacctgggtcgcaccgaccccgcgacgtgaggagc
atcttcgagcagccacaggatccccgcgtcttggccgagagaggcgaggggcaccgtttc
gtggaactggcgctgcggggcggcccgggctggtgtgacctgtgcggacgagaggtgctg
cggcaggcgctgcgctgcgctaactgtaaattcacctgccacccggagtgccgcagcctg
atccagctggactgcagacagaaggggggccctgccctggatagacgctctccagaaagc
accctcaccccaaccttgaaccagaatgtctgtaaggcagtggaggagaaacagcacctg
cccacgatacaggagatcaagcagaagattgacagctataacagcagggagaagcactgc
ctgggcatgaagctgagtgaagatggcacctacacaggtttcatcaaagtgcatttgaag
ctccgacggccagtgacggtgcccgctgggatccggccccagtccatctatgatgccatt
aaggaagtgaaccctgcagccaccacagacaagcggacgtccttctacctgccactcgat
gccatcaagcagctacacatcagcagcaccaccactgttagtgaggtcatccaggggctg
ctcaagaagttcatggttgtggacaacccacagaagtttgcactttttaagcggatacac
aaagatggacaagtgctcttccagaaactctccattgctgactatcctctctaccttcgt
ctgctcgctgggcctgacaccgatgttctcagctttgtgctaaaggagaatgaaactgga
gaggtggagtgggatgccttttccattcctgaactccagaactttttaactatcctggaa
aaagaggagcaggacaagatccatcaactgcagaagaagtacaacaaattccgtcagaaa
ctggaagaggcgttacgagagtcccaagggaagccggggtaa

DBGET integrated database retrieval system