KEGG   Mus caroli (Ryukyu mouse): 110294384
Entry
110294384         CDS       T05910                                 

Gene name
Dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal00240  Pyrimidine metabolism
mcal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110294384 (Dck)
   00240 Pyrimidine metabolism
    110294384 (Dck)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     110294384 (Dck)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 CoaE
Other DBs
NCBI-GeneID: 110294384
NCBI-ProteinID: XP_021018251
Ensembl: MGP_CAROLIEiJ_G0027379
UniProt: A0A6P5PK20
Position
5
AA seq 260 aa
MATPPKRFCPSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQVSEDWEVVPEPVARWCN
VQNTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTSFDYLQEVPVLTLDVNE
DFKDKHESLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacctaagaggttctgcccttctccctcgaccagctccgaggggacccgc
atcaagaagatttccatcgaggggaacatcgctgctgggaagtcaacgtttgtgaatatc
ctaaagcaagtctctgaggattgggaagtggttcccgagcctgtggccaggtggtgcaat
gtgcagaatactcaggatgaatttgaggaattgacaacgtctcagaagagcggcgggaat
gttcttcaaatgatgtatgagaaacctgaacggtggtctttcaccttccaatcatatgcc
tgtctcagccggatccgagcccagcttgcctctctcaatggcaagctcaaagatgcagag
aaacctgtattattttttgaaagatctgtgtatagtgacaggtacattttcgcttctaat
ttgtacgaatctgactgcatgaatgaaacagagtggaccatatatcaagactggcacgac
tggatgaacagccagtttggccaaagccttgaattggatggaataatctatcttcgagct
actccggagaaatgcttaaacagaatataccttcggggaagaaatgaagaacaaggcatt
cctcttgagtatttagagaaacttcactataaacatgaaagctggctccttcatcggact
ctgaaaaccagctttgattatctgcaagaggtgcccgtcctcacactggatgttaatgaa
gactttaaagacaaacacgaaagcctggttgaaaaggtcaaagaatttctgagtactttg
tga

DBGET integrated database retrieval system