KEGG   Mus caroli (Ryukyu mouse): 110295662Help
Entry
110295662         CDS       T05910                                 

Gene name
Suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00020  Citrate cycle (TCA cycle)
mcal00640  Propanoate metabolism
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
Module
mcal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110295662 (Suclg1)
   00640 Propanoate metabolism
    110295662 (Suclg1)
Enzymes [BR:mcal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110295662 (Suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110295662 (Suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2 Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 110295662
NCBI-ProteinID: XP_021019748
Ensembl: MGP_CAROLIEiJ_G0028515
Position
6
AA seq 294 aa AA seqDB search
MVSGSSGLAAARLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQAKEKTG
ATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHKLTRQGTTRLIGPNC
PGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFN
GTDFIDCLEVFLNDPATEGIILIGEIGGHAEENAAEFLKEHNSGPKAKPVVSFIAGITAP
PGRRMGHAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggtctccggcagcagcggcctcgccgccgcccgcctgctgtcgcgcaccttcctcctg
caacagaatgggatacgacacgggtcttacacagcctctcggaaacatatctatattgat
aaaaatacgaagattatttgccagggtttcacaggcaagcaggccaaagagaaaacagga
gcgacggcttctgtcatctatgtccctcctccttttgctgctgctgccattaatgaagca
atcgacgcggagattcccttggttgtgtgcattacggaaggtattccgcagcaggatatg
gtgcgggtcaagcacaaactgacacgccagggaacgacgaggctaatcgggccaaactgc
cccggcgtcatcaaccctggagaatgcaaaatcggcatcatgcctggccacattcacaag
aagggaagaataggtatcgtgtccaggtccggtactctgacttacgaagcagttcaccaa
acaacccaagtcggattggggcagtccttgtgtattggcattggaggtgacccttttaat
gggactgattttattgattgccttgaagtcttcctgaatgatccagccacagaaggcatc
atactgattggtgaaattggtggtcacgctgaagaaaatgctgccgagtttctgaaggag
cataactcaggtccaaaggccaagcctgtagtgtccttcattgctggtataactgctcct
cctggcagaaggatgggccatgcaggggcgattattgctggaggaaaaggtggcgctaaa
gagaagatctctgctcttcagagtgccggggtggttgtcagcatgtcccccgcacagctg
ggaaccaccatttataaggagtttgaaaagaggaagatgctttga

DBGET integrated database retrieval system