KEGG   Mus caroli (Ryukyu mouse): 110296113Help
Entry
110296113         CDS       T05910                                 

Gene name
Camk1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04020  Calcium signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110296113 (Camk1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110296113 (Camk1)
   04925 Aldosterone synthesis and secretion
    110296113 (Camk1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    110296113 (Camk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110296113 (Camk1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110296113 (Camk1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   110296113 (Camk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH RIO1 PaaA_PaaC Tyrosinase
Motif
Other DBs
NCBI-GeneID: 110296113
NCBI-ProteinID: XP_021020321
Ensembl: MGP_CAROLIEiJ_G0028721
Position
6
AA seq 374 aa AA seqDB search
MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTGSHGELLTPTAGGPAAGCCCRDCCVEPGS
ELPPAPPPSSRAMD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccaggggcagtggaaggccccaggtggaagcaggcggaagacattagggatatttat
gacttcagagatgttctgggcacgggtgccttctcagaagtgatcctggcagaggacaag
aggactcagaaactggtggccatcaaatgcattgccaagaaagccctcgagggcaaagaa
ggcagcatggagaatgagattgccgtcttacacaagatcaagcaccccaacattgtagcc
ttggatgacatctacgagagtgggggccacctctacctcatcatgcagctggtttcaggt
ggagagctgtttgaccgaattgtggagaaaggattctacacagaacgggatgccagccgc
ctcatcttccaggtgctggatgctgtcaagtacctgcatgacctgggcattgtgcaccgg
gatctcaagccagagaacctgctgtactacagtctggatgaagactccaaaatcatgatc
tctgactttggcctttccaagatggaggacccaggcagtgtgctctccacagcctgtggg
actccaggatatgtggcccctgaggtcctggcccagaagccctacagcaaggctgtggat
tgctggtccataggagtcattgcctatatactgctctgtggctacccacccttttatgat
gaaaatgatgccaaactctttgaacagattttgaaggcagagtatgagtttgactctcct
tattgggacgacatctctgactctgccaaagatttcatacgacatttgatggagaaagac
ccagagaagaggtttacctgtgagcaggccttgcagcacccatggattgcaggagataca
gctctggataagaatatccaccagtcagtgagcgagcagatcaagaagaactttgccaag
agcaagtggaagcaagctttcaatgccactgctgtggttcgacacatgaggaagctgcag
ctgggaaccagtcaggaggggcaggggcagactggcagccacggggagctgctgacacca
acagctggtgggccagcagctggctgctgctgccgagactgctgtgtggaaccaggctcg
gaactgccccctgcaccacccccaagctctagggccatggattga

DBGET integrated database retrieval system