KEGG   Mus caroli (Ryukyu mouse): 110296602
Entry
110296602         CDS       T05910                                 

Gene name
Ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110296602 (Ankrd53)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    110296602 (Ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 110296602
NCBI-ProteinID: XP_021020967
Ensembl: MGP_CAROLIEiJ_G0028564
Position
6
AA seq 497 aa
MPRASLRRHSKASTPPRSHTTPRRTGPSDSRRRPGTKVQPRPSVQGGTRQAEHDLKVSSP
NSESSQQYSTSESWSHKVIANYSEFFAASLGNVDWLRFCVNPERKEIIVDDKGFTAIHFA
AQKCQLSCLKVLIEDYKYPVDLPTNKGQTPLHLVIHKNNKSDILPCIDYLLKKGAAINSQ
TCNGSTPLHLASCNGLLGCVKLLVQSGANVHARDATGFKPIDYCRLWNHRTCARFLKDVM
WKHDKKVFAQEMEKLRTLREKLTILEHRYLTEYQKEHQILREAHFRKWLQSKAQTLGSAD
SKQKAGVRPWSLASNTLRCPITESLHYPSVEAQLKNLPSPVVPPKPIYKQTTISRPKLWN
YSANPARSPITNIGHPQDIRLGVHPEPYKEHDFCRFLEVTRNKHGGACLRTVDRQLVTPV
PQLPFEMMVRVLYPGSQPYRMKVPQGLYPRDILKVLEKRHVGGTCTNTMAMTLRETFDKP
FLDSLEACRTRVAPPSK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgccacgcgcctcgctgcgtcgtcattccaaagccagtacaccccctaggagccacacc
actccgcgcaggactgggccctcagattccagaaggcgcccagggacaaaagtgcagccc
cgcccatctgtacaaggaggcacgcggcaagcggaacacgacttgaaggtttccagtccc
aactccgaatcctcgcagcagtacagtacctccgagtcttggagccataaagtgatcgcg
aactactccgagtttttcgcagcctcactgggcaatgtggactggcttcggttctgtgtg
aatccggagcgcaaggagattatagtcgacgacaagggcttcacagccatccacttcgca
gcccagaaatgccagctttcctgccttaaggtcttaatagaggactacaaatatcctgtg
gatctgcccaccaacaaaggccagacgcccctgcatttggtcatccataaaaacaacaaa
tcggacatcctcccctgcattgactacctgctcaagaaaggggcagccatcaactcgcag
acatgcaacggctccacacccctgcacctggcttcctgcaatggcctactgggatgtgtt
aagctgctggtacagagtggagccaatgtgcatgcccgagatgccacgggcttcaagccc
atcgactactgcagactttggaaccaccgtacctgtgcccggttcttgaaggatgtcatg
tggaaacatgataagaaggtctttgcccaggagatggagaagctgaggaccttgagggag
aagctgactattctggagcatcgctacctgactgaataccaaaaagaacatcaaattctg
agagaggctcatttcagaaagtggctccaaagcaaggcccagaccctgggctctgccgac
tccaagcaaaaggctggtgtccgaccttggtcattggcctccaacactttaagatgccca
ataactgaaagcctccattatccatctgtggaagctcagctgaaaaacttgccctcaccc
gtggtgccacccaagcccatctacaagcagaccaccatcagtcggcccaagttatggaac
tatagtgctaaccctgccaggtcccctatcacaaacattggccacccacaggatatacgc
ctgggtgtgcacccagaaccctataaggaacatgacttctgcagattcctggaggtgact
cgaaataaacatgggggtgcatgcctgcgcacagtggaccgtcagttggtgacacctgta
ccccagctgccttttgagatgatggtccgggtgctttacccagggtctcaaccctacagg
atgaaagtgccccagggcttgtatccacgggacatactcaaagtacttgagaaacggcat
gtgggaggtacctgtaccaatacaatggccatgaccctacgtgagacatttgataaaccc
ttcctcgattccttggaagcttgccggactcgagtagccccaccctccaagtga

DBGET integrated database retrieval system