KEGG   Mus caroli (Ryukyu mouse): 110297893Help
Entry
110297893         CDS       T05910                                 

Gene name
Blvrb
Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00740  Riboflavin metabolism
mcal00860  Porphyrin and chlorophyll metabolism
mcal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    110297893 (Blvrb)
   00860 Porphyrin and chlorophyll metabolism
    110297893 (Blvrb)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     110297893 (Blvrb)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     110297893 (Blvrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD TrkA_N Semialdhyde_dh DXP_reductoisom
Motif
Other DBs
NCBI-GeneID: 110297893
NCBI-ProteinID: XP_021022631
Ensembl: MGP_CAROLIEiJ_G0029412
Position
7
AA seq 206 aa AA seqDB search
MTVKKIAIFGATGRTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPQPAHVVVGDVRQASD
VDKTVAGQEAVIVLLGTGNDLSPTTVMSEGTRNIVTAMKAHGVDKVVACTSAFLLWDPTK
VPQRLQDVTDDHIRMHKILQESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHD
LGHFMLRCLTTNEYDGHTTYPSHQYD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcaagaagatcgcgatcttcggtgccaccggcaggaccgggctcaccacactg
gcgcaggcggtgcaagcaggttacgaggtgacggtgctggttcgagactccagcaggctg
ccgtcagaagggccccagccagcccatgtggtggtgggagatgttcggcaggcgtctgat
gtggacaagactgtggctgggcaggaagctgtcatcgtgctactgggcactggcaacgac
ctcagtcccactacagtcatgtccgagggcacccggaacattgtgacagccatgaaggca
catggagtggacaaggtcgtggcctgcacctcggccttcctactatgggacccgaccaag
gtgccccaacgcctgcaggacgtgaccgatgaccacatccggatgcataagattctgcag
gagtcagggctgaaatacgtggcagtgatgcccccacacataggagaccaaccactaact
ggggcctacacagtgaccctggatggacgagggccctcgagggttatatccaagcatgac
ctgggccacttcatgctacggtgcctcaccaccaatgagtatgacggacacaccacctac
ccctcccaccaatatgactag

DBGET integrated database retrieval system