KEGG   Mus caroli (Ryukyu mouse): 110298243Help
Entry
110298243         CDS       T05910                                 

Gene name
Pop4
Definition
(RefSeq) ribonuclease P protein subunit p29
  KO
K03538  ribonuclease P protein subunit POP4 [EC:3.1.26.5]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03008  Ribosome biogenesis in eukaryotes
mcal03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110298243 (Pop4)
   03008 Ribosome biogenesis in eukaryotes
    110298243 (Pop4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mcal03009]
    110298243 (Pop4)
   03016 Transfer RNA biogenesis [BR:mcal03016]
    110298243 (Pop4)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110298243 (Pop4)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     110298243 (Pop4)
Ribosome biogenesis [BR:mcal03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     110298243 (Pop4)
Transfer RNA biogenesis [BR:mcal03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    110298243 (Pop4)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    110298243 (Pop4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0086
Motif
Other DBs
NCBI-GeneID: 110298243
NCBI-ProteinID: XP_021023027
Ensembl: MGP_CAROLIEiJ_G0029600
Position
7
AA seq 221 aa AA seqDB search
MKAAIYHAFSHKEAKDHDVQELGSQRAEAFVRAFLKQSIPHMSQEDCESHLQRKAVILEY
FTRIKPKPRPKKKSKGLSAKQRRDMRLFDIKPEQQRYSLFLPLHELWKQYIRDLCNGLKP
DTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGVTGILLQETKHVFKIITKEDHLKVIPK
LNCVFTIEIDDFISYIYGSKFQLRASERSAKKFKAKGSIDL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgccatctaccatgccttttctcataaagaagccaaggaccacgatgtgcag
gagctgggaagccagcgggctgaggcctttgtgcgggccttcctgaagcagagcatacct
cacatgagccaagaagactgtgagagccatctgcagcgcaaggccgtgatcttggaatat
ttcactcgcataaagccaaagccaaggccaaagaagaaatccaaaggcctctctgccaaa
cagaggagagacatgcggctctttgacattaaaccagagcaacagagatacagccttttc
ctccctctccatgaactctggaaacagtacatccgtgacctgtgcaatgggctcaagcca
gacacgcagccacagatgattcaggccaagctcctaaaggcagatcttcatggtgctatt
atttcagtcacgaaatccaagtgcccctcctatgtgggagttacaggaatccttctgcag
gagaccaagcatgtctttaagatcatcaccaaagaagaccacctaaaagtcatccccaag
ctaaattgtgtgttcaccatagaaattgatgacttcatttcctacatttatggaagcaaa
ttccagcttcgggcaagtgagcggtctgccaagaagttcaaagcaaagggatcaattgac
ctgtga

DBGET integrated database retrieval system