KEGG   Mus caroli (Ryukyu mouse): 110299207Help
Entry
110299207         CDS       T05910                                 

Gene name
Il4i1
Definition
(RefSeq) L-amino-acid oxidase
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00250  Alanine, aspartate and glutamate metabolism
mcal00270  Cysteine and methionine metabolism
mcal00280  Valine, leucine and isoleucine degradation
mcal00350  Tyrosine metabolism
mcal00360  Phenylalanine metabolism
mcal00380  Tryptophan metabolism
mcal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcal01100  Metabolic pathways
Module
mcal_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110299207 (Il4i1)
   00270 Cysteine and methionine metabolism
    110299207 (Il4i1)
   00280 Valine, leucine and isoleucine degradation
    110299207 (Il4i1)
   00350 Tyrosine metabolism
    110299207 (Il4i1)
   00360 Phenylalanine metabolism
    110299207 (Il4i1)
   00380 Tryptophan metabolism
    110299207 (Il4i1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    110299207 (Il4i1)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     110299207 (Il4i1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 AlaDh_PNT_C FAD_binding_2 HI0933_like Pyr_redox FAD_oxidored Thi4 FAD_binding_3 GIDA MCRA Lycopene_cycl Pyr_redox_3 UDPG_MGDP_dh_N Trp_halogenase FMO-like 3HCDH_N Shikimate_DH ApbA
Motif
Other DBs
NCBI-GeneID: 110299207
NCBI-ProteinID: XP_021024503
Ensembl: MGP_CAROLIEiJ_G0029676
Position
7
AA seq 640 aa AA seqDB search
MGARRVPQRPACTLRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLLKVVTLGL
NRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEKTGWIGELG
AMRMPSSHRILHKLCRSLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPEKLGYNLNNR
ERGHSPEDIYQMALNKAFKDLKVLGCKKAMNKFNKHTLLEYLLEEGNLSRPAVQLLGDVM
SEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGPVLLNAPVVSITQG
RNDVRVHIASSLHPVKTLTADVVLLTASGPALQRITFSPPLTRKRQEALRALHYVAASKV
FLSFRRPFWHEEHIEGGHSNTDRPSSLIFYPARGEGSLLLASYTWSDAAAPFAGLSTDQT
LRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPYSQGGFVVQPPLYGREAEDYDWSAPFG
RIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMMEHAQEEANYLDQYPEG
ERPEEQQARDEVSQDEQEPSHKHLLVETSPEGQQHVFVEAIPELQGHVFVETIPQEKGHV
HQNIYPSEHVQAHGEVIPELQGHGHVGSGTPQMHRVGDHS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaggagagtgccacaaagaccagcatgcaccctgcgtcttgtcctggcggcc
acccttcttggtctggcaggctctctggactggaaggcagcctccagcctgaaccctatt
gagaagtgtatggaggaccacgattatgagcagctactcaaggtggtgaccttgggtctc
aatcggacttcgaagccccagaaggtggtagtggttggtgcaggcgtggccgggctggta
gcagccaagatgctcagtgatgcaggacacaaggtcaccatcctggaggcagataacagg
attgggggccgtatcttcactttccgggatgagaagacaggctggataggggagcttggg
gccatgcgaatgcccagctctcacaggatcttgcacaagctctgcaggagcctgggcctc
aacctgactcagttcacacagtatgatgagaacacgtggacggaggtgcataatgtgaag
ctgcgaaactatgtggtggagaagatgccagaaaagctgggctacaacctgaacaacagg
gaaaggggccattctccagaggacatctaccagatggcactcaacaaggccttcaaagac
ctcaaggtcttgggctgcaagaaagccatgaataagttcaacaagcatacgcttctggaa
tacctcctcgaggaaggcaacctgtcccggccggcggtgcagctcctgggagatgtgatg
tccgaggagggcttcttctacctcagctttgcagaagcattacgtgcgcacgcctgcctg
agcgatcgactccggtacagccgcatcgtgggtggctgggacctgcttccgcgagctctg
ctgagctcactgtccgggccggtgctgttgaacgcgcccgtggtgtcgatcactcagggg
aggaacgatgtgcgcgtgcacatcgcctcctcgcttcaccccgtgaagacgctgacagcc
gatgtggtgctgctaactgccagtgggcccgcgctgcagcgcattaccttctcgccgccc
ttgactcgcaagaggcaggaggcactgcgcgcccttcactacgtagcagccagcaaggtt
tttctgagtttccgtcggcctttctggcacgaggagcacatcgagggcggccactccaac
actgaccgcccatcgagcctcatattctatcccgcacggggcgagggctcactgcttctg
gcctcctacacatggtcggacgctgcagcccccttcgctggactgagcaccgaccagacc
ctgcgtttggtgctccaggacgtggcagccctgcacgggcctgtggtgttccggctgtgg
gacggcaggggtgtggtcaagcgctgggcagaggacccatatagccagggaggcttcgtg
gtgcagccgccattgtatgggcgcgaggccgaggactatgactggtcagcccccttcggc
cgcatttacttcgcgggcgagcacacagctctcccgcatggctgggtagagaccgctgtc
aagtctgggttgcgggccgcagtgagaatcaataataactatgggtacggggaggtggac
ccccagatgatggagcatgcacaagaagaggccaactatctggaccagtatcctgaaggg
gagaggcccgaggagcagcaggcgcgggacgaagtcagccaagatgaacaagagccctct
cacaaacacttgttggtggaaacaagccccgaggggcagcaacacgtgtttgtggaggcc
attcccgagctgcagggacacgttttcgtggagactatcccccaggagaaggggcacgtc
caccagaatatatatccttcggagcatgtacaggcgcatggggaagtcatccctgaatta
caagggcatgggcatgtgggatctggcaccccgcaaatgcaccgagtgggggaccactcc
taa

DBGET integrated database retrieval system