KEGG   Mus caroli (Ryukyu mouse): 110299579Help
Entry
110299579         CDS       T05910                                 

Gene name
Cdk15
Definition
(RefSeq) cyclin-dependent kinase 15 isoform X1
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110299579 (Cdk15)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110299579 (Cdk15)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110299579 (Cdk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 110299579
NCBI-ProteinID: XP_021024986
Ensembl: MGP_CAROLIEiJ_G0014177
Position
1
AA seq 436 aa AA seqDB search
MGQELCAKRLQPGCSCYHRSEGGEAHSCQRSQPGSTEPAVFELTDLKEASSSMASFHPRG
LEAASAQKLESKRPRSNSDSFQEENLRQGLPWKKSLPFGAASSYLNLEKLGEGSYAKVYK
GISRINGQLVALKVIRMNAEEGVPFTAIREASLLKGLKHANIVLLHDIVHTKETLTFVFE
YMHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQRVLHRDLKPQNLLLSHLGELK
LADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPL
FPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFQPPKPQSLQIVWDRLGGVPE
AEDLASQMLKGFPRDRVSAQEALVHDYFSVLPSQLYQLPDEESLFAVSGVKLKPEMCDLS
ASYRKRHHLIGVNKCW
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagagctgtgtgcaaagaggctacagccaggatgcagttgctaccaccgttcg
gagggaggggaggcgcacagctgtcagagaagccagcctggaagcaccgagcctgctgta
ttcgagctaacagatctaaaagaagcatccagttccatggcttcatttcaccccagggga
ctcgaggctgccagtgcccagaagttggagagtaaaaggccccggagtaacagtgattct
tttcaggaagagaatctgaggcaggggttgccatggaagaagagcctcccttttggggca
gcctcatcttacttgaacttggagaagctgggtgaaggttcttatgccaaagtttacaag
ggcatcagcaggataaatggacaactagtagctctcaaagtcatccgcatgaatgcagag
gagggagtccctttcacagccatccgggaagcgtctctcctgaagggcttgaagcacgcc
aatattgtcctcttgcatgacattgttcacaccaaagagactctgacattcgtatttgaa
tacatgcataccgacctggcccagtacatgtctcagcatcctggagggcttcatcctcac
aatgtcaggcttttcatgtttcaacttctgcggggcctggcatacatccaccaccagcgt
gttctccacagggacctgaaacctcagaacctgctcctcagtcacctgggagagctcaaa
ctggctgattttggtcttgctcgagccaagtccattcctagccagacatactcttcagaa
gtggtgacactctggtaccggccacctgacgctttgctgggagccactgagtactcctct
gagctagacatatggggcgcaggctgcatctttattgaaatgttccagggtcaacctctg
tttcctggggtatccaacatccttgaacagctggagaagatctgggaggttctgggagtc
cctacagaggatacctggcctggagtctccaaactgcctaactacaatccagaatggttc
cagccacctaaacctcaaagcctgcagattgtctgggacaggctgggtggagttcctgaa
gctgaagacttggcctcccagatgctaaaaggcttccccagggaccgtgtctcagcccaa
gaagcactggttcatgattatttcagtgtcctgccatcccagttgtaccagcttcctgat
gaggagtctctgtttgcagtttcgggagtgaagctaaagccagaaatgtgtgacctttcg
gcttcctacaggaagagacaccacctaatcggggttaacaaatgttggtga

DBGET integrated database retrieval system