KEGG   Mus caroli (Ryukyu mouse): 110300659Help
Entry
110300659         CDS       T05910                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00232  Caffeine metabolism
mcal00983  Drug metabolism - other enzymes
mcal01100  Metabolic pathways
mcal05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    110300659
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110300659
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110300659
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     110300659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 110300659
NCBI-ProteinID: XP_021026572
Ensembl: MGP_CAROLIEiJ_G0031098
Position
8
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCGEAMHLDLQDIFDHIV
RKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSEMVHLLVQVTISDRKYI
VDSAYGGSYQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQIRREQYVPNEEFVNSDL
LEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSFCSLQTSEGVHCLVGSTFT
SRRFSYKDDVDLVEFKYVNEEEIEDVLKTAFGISLERKFVPKHGELVFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgaagcatactttgaaaggattggttacaagaactcagtgaataaattggac
ttagccacattaactgaagttcttcagcaccagatgcgagcagttccttttgagaatctt
aacatgcattgtggagaagccatgcatctggatttacaggacatttttgaccacatagta
aggaagaagagaggtggatggtgtctccaggttaatcatctgctgtactgggctctgacc
aaaatgggctttgaaaccacaatgttgggaggatatgtttacataactccagtcagcaaa
tatagcagtgaaatggtccaccttctagtacaggtgaccatcagtgacaggaagtacatt
gtggattccgcctatggaggctcctaccagatgtgggagcctctggaattaacatctggg
aaggatcagcctcaggtgcctgccatcttccttttgacagaggagaatggaacctggtac
ttggaccaaatcagaagagagcagtatgtcccaaatgaagaatttgttaactcagacctc
cttgaaaagaacaaatatcgaaaaatctactcctttactcttgagccccgagttatcgag
gattttgaatatgtgaatagctatcttcagacatcgccagcgtctgtgtttgtaagcaca
tcgttctgttccttgcagacctcagaaggggttcactgtttagtgggctccacctttaca
agtaggagattcagctataaggacgatgtagatctggttgagtttaaatatgtgaatgag
gaagaaatagaagacgtactgaaaaccgcatttggcatttctttggagagaaagtttgtg
cccaaacatggtgaactagtttttactatttag

DBGET integrated database retrieval system