KEGG   Mus caroli (Ryukyu mouse): 110300709Help
Entry
110300709         CDS       T05910                                 

Gene name
Faslg
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6 isoform X1
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04068  FoxO signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04217  Necroptosis
mcal04650  Natural killer cell mediated cytotoxicity
mcal04722  Neurotrophin signaling pathway
mcal04932  Non-alcoholic fatty liver disease (NAFLD)
mcal04940  Type I diabetes mellitus
mcal05142  Chagas disease (American trypanosomiasis)
mcal05143  African trypanosomiasis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05320  Autoimmune thyroid disease
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110300709 (Faslg)
   04010 MAPK signaling pathway
    110300709 (Faslg)
   04068 FoxO signaling pathway
    110300709 (Faslg)
   04151 PI3K-Akt signaling pathway
    110300709 (Faslg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110300709 (Faslg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110300709 (Faslg)
   04217 Necroptosis
    110300709 (Faslg)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110300709 (Faslg)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110300709 (Faslg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300709 (Faslg)
   05205 Proteoglycans in cancer
    110300709 (Faslg)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110300709 (Faslg)
   05330 Allograft rejection
    110300709 (Faslg)
   05332 Graft-versus-host disease
    110300709 (Faslg)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110300709 (Faslg)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    110300709 (Faslg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110300709 (Faslg)
   05162 Measles
    110300709 (Faslg)
   05164 Influenza A
    110300709 (Faslg)
   05161 Hepatitis B
    110300709 (Faslg)
   05160 Hepatitis C
    110300709 (Faslg)
   05168 Herpes simplex virus 1 infection
    110300709 (Faslg)
   05163 Human cytomegalovirus infection
    110300709 (Faslg)
   05165 Human papillomavirus infection
    110300709 (Faslg)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    110300709 (Faslg)
   05143 African trypanosomiasis
    110300709 (Faslg)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110300709 (Faslg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110300709 (Faslg)
   04052 Cytokines and growth factors [BR:mcal04052]
    110300709 (Faslg)
   04090 CD molecules [BR:mcal04090]
    110300709 (Faslg)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110300709 (Faslg)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Tumor necrosis fators
   110300709 (Faslg)
CD molecules [BR:mcal04090]
 Proteins
  110300709 (Faslg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 110300709
NCBI-ProteinID: XP_021026627
Ensembl: MGP_CAROLIEiJ_G0014766
Position
1
AA seq 278 aa AA seqDB search
MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSSGPRGPDQRRPPPPPPPVSPLPPPSQ
PPPLPPLIPLKKDHNTNLWLPVIFLMVLVALVGMGLGMYQIFHLQKELAELREFTNQSLK
VSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVI
NEAGLYFIYSKVYFRGQSCNNQPLNHKVYMRNSKYPGDLVLMEEKRLNYCTTGQIWAHSS
YLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccatgaattacccatgtccccagatcttctgggtagacagcagtgccact
tcgtcttgggctcctccagggtcagtttttccctgtccatcttctgggcctcgagggccg
gaccaaaggagaccgccacctccaccaccacctgtgtcacctctaccaccgccatcacaa
ccacccccactgccgccactgatccctctaaagaaggaccacaacacaaatctgtggcta
ccggtgatatttctcatggttctggtggctctggttggaatgggattaggaatgtatcag
atcttccacctgcagaaggaactggcagaactccgtgagttcaccaaccaaagccttaaa
gtatcatcttttgaaaagcaaatagccaaccccagtacaccctctgaaaaaaaagagccg
aggagtgtggcccatttaacagggaacccccactcaaggtccatccctctggaatgggaa
gacacatatggaaccgctctgatctctggagtgaagtataagaaaggtggccttgtgatc
aacgaagctgggttgtacttcatatattccaaagtatacttccggggtcagtcttgcaac
aaccagcccctaaaccacaaggtctatatgaggaactctaagtatcctggggatctggtg
ctaatggaggagaagaggttgaactactgcactactggacagatatgggcccacagcagc
tacctgggggcagtatttaatcttaccagtgctgaccatttatatgtcaacatatctcaa
ctctctctgatcaattttgaggaatctaagaccttttttggcttgtataagctttaa

DBGET integrated database retrieval system