KEGG   Mus caroli (Ryukyu mouse): 110301501Help
Entry
110301501         CDS       T05910                                 

Gene name
Nmnat3
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00760  Nicotinate and nicotinamide metabolism
mcal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    110301501 (Nmnat3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     110301501 (Nmnat3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     110301501 (Nmnat3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 110301501
NCBI-ProteinID: XP_021027633
Ensembl: MGP_CAROLIEiJ_G0032546
Position
9
AA seq 245 aa AA seqDB search
MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGRYQVIEGIISPVNDSYGKKDLVA
SHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHRELLRSSAQMDGPDASKTP
SASAALPELKLLCGADVLKTFQTPNLWKDRHIQEIVEKFGLVCVSRSGHDPERYISDSPI
LQQFQHNIYLAREPVLNEISATYVRKALGQGQSVKYLLPEAVITYIRDQGLYINDGSWKG
KGKSG
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccgaatccccgtggtgcttctggcctgtggttccttcaaccccatcacgaat
atgcacctgcgcttgtttgaggtggccagagaccacctacaccaaacaggaaggtaccag
gtgattgagggcatcatctcacccgtcaatgacagctatgggaagaaagacctggtggct
tcccatcaccgagtggccatggcccggctggccctgcagacatctgactggattcgggtg
gacccctgggagagtgagcaggcgcagtggatggaaacggtgaaggtgctgaggcaccat
cacagggaactgctcagatcctcagcccagatggatggcccagacgccagcaagacacca
tcagcctctgcagcactgccagagttgaaactcctctgtggagctgatgtcctcaagacc
ttccagacccccaacctctggaaagacaggcacatccaggagatagtggagaagttcggc
ttggtgtgcgtgagcaggagcggccatgacccggaaaggtacatctcggactcgcccatc
ctccagcagtttcagcacaacatttacctggccagggaacccgttctgaacgagatcagt
gccacctacgtcaggaaagccttgggccaagggcagagcgtgaagtacctccttcccgag
gccgtcatcacctacatcagggaccagggcctctacatcaatgacggttcctggaaaggg
aaagggaagtctggctag

DBGET integrated database retrieval system