KEGG   Mus caroli (Ryukyu mouse): 110301665Help
Entry
110301665         CDS       T05910                                 

Gene name
Gucy1a2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal04022  cGMP-PKG signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04730  Long-term depression
mcal04921  Oxytocin signaling pathway
mcal04924  Renin secretion
mcal04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110301665 (Gucy1a2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    110301665 (Gucy1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110301665 (Gucy1a2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110301665 (Gucy1a2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110301665 (Gucy1a2)
   04924 Renin secretion
    110301665 (Gucy1a2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110301665 (Gucy1a2)
  09154 Digestive system
   04970 Salivary secretion
    110301665 (Gucy1a2)
  09156 Nervous system
   04730 Long-term depression
    110301665 (Gucy1a2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110301665 (Gucy1a2)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110301665 (Gucy1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Motif
Other DBs
NCBI-GeneID: 110301665
NCBI-ProteinID: XP_021027894
Ensembl: MGP_CAROLIEiJ_G0031738
Position
9
AA seq 626 aa AA seqDB search
MTLKRTLQYYEHQVIGYRDAEKNFHNISKRCSYADHSNKEEIEDVSGILQCTANVLGLQF
QEIQERFGEEFFKICFDENERVLRAVGSTLQDFFNGFDALLEHIRTSFGKQATLESSSFL
CKELPEGTLMLHYFHPHHTVGFAMLGMIKAAGKRIYHLNVEVEQIENEKLCFDGSNPSNC
SCLTFLIKECETTQITKDVPQGTSQVPADLRISINTFCRAFPFHLMFDSNMVVLQLGEGL
RKQLRYDTHRALKFEDCFEIVSPMINATFDRVLLRLSTPFVIRTKPEASGTENEDKVMEI
KGQMIHVPESSAILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLK
KRMDKLKATLERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSD
IVGFTAICAQCTPMQVISMLNELYTRFDHQCGLLDIYKVETIGDAYCVASGLHRKSLCHA
KPIALMALKMMELSEEVLTPDGKAIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASK
FESGSHPRRINVSPTTYQLLKREDSFTFIPRSREELPDNFPKEIPGVCYFLELRTDPKPP
KPSLSSSRIKKVSYNIGTMFLRETSL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaagaggacattgcagtattatgaacaccaagtcattggttatagggatgca
gaaaagaatttccacaatatctctaaaagatgctcctatgcagaccattccaacaaagag
gaaattgaagatgtctcaggaattcttcagtgtactgctaatgtactcggactgcagttc
caagaaattcaagaaagatttggtgaggaattctttaagatatgctttgatgagaatgaa
agagtccttcgagctgtgggcagcacattgcaggacttcttcaatggctttgatgcgttg
ttagaacacattaggacttcttttgggaaacaggccactctagagtcatcatctttccta
tgcaaagagcttcctgaaggtactctcatgctccattacttccatcctcaccatacggtg
ggttttgcaatgctgggaatgattaaggctgcaggaaagagaatctatcacttaaatgtg
gaagttgaacaaattgaaaatgagaaactctgctttgatggttcaaacccaagcaattgt
agctgtcttactttccttatcaaagaatgtgaaactactcagatcacaaaggacgttcca
caaggtacttcccaagttcctgcagacctcagaatcagcatcaacaccttctgcagagcc
ttccccttccatttgatgtttgactccaacatggtggtccttcagcttggggagggccta
cggaaacaacttcgatatgacactcacagagcgctgaagtttgaggactgttttgagatc
gtctctccaatgattaatgccaccttcgatagagtcttgctacgattgtccactccattt
gttataaggaccaagcccgaagcttctggtactgagaatgaagataaggtgatggaaatc
aaaggacaaatgatccatgtcccagaatcaagtgccattttgtttttgggatctccatgt
gtggacaagttggatgaactgatgggccgaggactgcatctctcagacatccctattcat
gatgccacccgagatgtcattttagttggagagcaagccaaggcccaggatggcttgaag
aagaggatggataaattaaaggccacattagaaagaactcaccaggccctggaagaagaa
aaaaagaagacagtggatctgctgtattccattttccctggtgatgtagcccagcagttg
tggcaagggcagcaagtacaggccagaaagtttgatgatgtcaccatgcttttctctgac
attgtgggctttacagccatatgtgctcagtgtactcccatgcaggtgatcagcatgctc
aatgaactctacacaagatttgatcaccagtgtggccttttggatatttacaaggtggaa
acaataggggacgcatactgtgtggcatcaggactgcacaggaaaagcctatgccatgca
aagcccattgctctgatggccttaaagatgatggagctttcagaagaagttctgactcct
gatggaaaagcaattcagatgcggataggcattcactcaggctctgtgctggctggtgtg
gtcggagtacgaatgccacgatattgtctttttggaaacaatgtcactctggcaagcaaa
tttgaatctggaagtcatcctcggcgtatcaatgtcagcccaactacttaccaattacta
aaacgagaagacagtttcacatttattcctcgttctcgagaagaacttccagacaacttt
ccaaaggaaattcctggggtctgctatttcctggagttaaggactgacccaaagccacca
aagccatccctatcttcatcgagaataaaaaaggtttcctacaatattggcacaatgttc
ctccgggaaacaagcctctga

DBGET integrated database retrieval system