KEGG   Mus caroli (Ryukyu mouse): 110303154Help
Entry
110303154         CDS       T05910                                 

Definition
(RefSeq) glutathione S-transferase theta-1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00480  Glutathione metabolism
mcal00980  Metabolism of xenobiotics by cytochrome P450
mcal00982  Drug metabolism - cytochrome P450
mcal00983  Drug metabolism - other enzymes
mcal01100  Metabolic pathways
mcal01524  Platinum drug resistance
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05225  Hepatocellular carcinoma
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110303154
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110303154
   00982 Drug metabolism - cytochrome P450
    110303154
   00983 Drug metabolism - other enzymes
    110303154
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303154
   05204 Chemical carcinogenesis
    110303154
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110303154
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110303154
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110303154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110303154
Enzymes [BR:mcal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110303154
Transporters [BR:mcal02000]
 Other transporters
  Pores ion channels [TC:1]
   110303154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 110303154
NCBI-ProteinID: XP_021029780
Ensembl: MGP_CAROLIEiJ_G0015450
Position
10
AA seq 240 aa AA seqDB search
MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG
GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF
PVFLGEQIPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGG
GCSVFEGHPRLAAWYQRVEAAVGKDLFREAHEVILKVKDCPPADLIIKQKLMPRVLAMIQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggttctggagctgtacctggatctgctgtcgcagccctgtcgcgccatttatatcttc
gccaagaagaacaatatcccgtttcagatgcatacggtggagctgcgcaagggtgagcac
ctcagcgatgcgtttgcccgggtgaaccccatgaagagggtaccagccatgatggatggt
ggcttcaccctgtgtgagagtgtggctatcctgctttacctggcacacaagtataaggtt
cctgaccactggtacccccaagacctgcaggctcgcgctcgtgtagatgagtacctggca
tggcagcatacgggccttcggagaagctgcctcagggccctgtggcataaggtgatgttc
cctgttttcctcggtgaacaaatacctcctgagacgctggcagccacattggcagaactg
gatgttaacctacaggtgcttgaagacaagttcctccaggacaaagacttccttgttggg
ccccacatctccctggccgacttggtggccatcacagagctgatgcatcctgtaggtggt
ggctgctcagtctttgaagggcatcccaggctggctgcatggtaccagcgagtggaggca
gctgtggggaaggacctcttccgggaagcccatgaagtcatcctgaaggtgaaggactgt
ccccctgctgacctcatcataaagcagaagctgatgcccagagtgctggccatgatccag
tga

DBGET integrated database retrieval system