KEGG   Mus caroli (Ryukyu mouse): 110303548
Entry
110303548         CDS       T05910                                 

Gene name
Rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110303548 (Rdh5)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110303548 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 110303548
NCBI-ProteinID: XP_021030317
Ensembl: MGP_CAROLIEiJ_G0015961
UniProt: A0A6P5QK46
Position
10
AA seq 320 aa
MWLPLLLGALLWAVLWLLRDRQSLPASDAFIFITGCDSGFGRLLALQLDQKGFQVLAGCL
TPSGAEDLQQMASSRLHTTLLDITDPQNVQQVAKWVKTRVGETGLFGLVNNAGVAGIIGP
TPWLTQDDFQRVLSVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRIAANGGGYCVSKF
GLEAFSDSLRRDMAPFGVQVSIVEPGFFRTPVTNLKSLESTLKACWTRLPPATQARYGEA
FLETSTDLRVQRRIMNLICDPDLTKVTSCLEHALTARHPRTRYSPGWDAKLLWLPASYLP
AKVVDAVLTWILPRPAQSVS
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttctgggtgccttgctgtgggcagtgctgtggttgctcagagac
cggcagagcctgccggccagcgatgctttcatcttcatcactggctgtgactctggcttt
gggcgccttctggcactgcaacttgaccagaagggcttccaagtcctggccggctgcctg
accccctctggggcagaagacctgcagcagatggcctcctcccgcctccacacaacactg
ctggatatcactgatccccagaatgtccagcaagttgccaaatgggtgaagacacgtgtt
ggagaaactgggctttttggtctggtgaataacgctggcgtagctggtatcatcgggccc
acaccatggctaacacaggatgatttccagagagtgctgagtgtgaacacactggggccc
atcggggtcacccttgccctgctgcccctgctacagcaggccaggggtcgggtggtcaac
atcaccagtgtcttgggccgcatagcagccaatggtgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggacatggctccgttcggagtacaagtc
tccattgtggagcctggcttctttcgaacccctgtgaccaacctgaagagtctggagagc
accctgaaggcttgttggacccggctacctccagctacacaggcccgctatggggaagcc
ttcctcgagacttctacagatcttcgagtgcagcgccgcatcatgaacctaatctgtgac
ccagacctaacgaaggtgaccagctgcctggagcatgccctgactgctcgccaccctcga
acacgctacagcccaggctgggatgccaagctgctctggctgcctgcctcctaccttcca
gccaaggtggtggatgctgtgctcacctggatccttccccggcccgcccagtcagtgtcc
tga

DBGET integrated database retrieval system