KEGG   Mus caroli (Ryukyu mouse): 110305582Help
Entry
110305582         CDS       T05910                                 

Gene name
Mrpl22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    110305582 (Mrpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mcal03011]
    110305582 (Mrpl22)
Ribosome [BR:mcal03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    110305582 (Mrpl22)
  Bacteria
    110305582 (Mrpl22)
  Archaea
    110305582 (Mrpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 110305582
NCBI-ProteinID: XP_021033257
Ensembl: MGP_CAROLIEiJ_G0016386
Position
11
AA seq 206 aa AA seqDB search
MAAALLRELGALRLPNLRIWATQTLRVLPPSCIHTSASLDISRKWEKKNKIVYPPQLPGE
PRRPAEIYHCRRQIKYSKDKMWYLAKMIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQD
MAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPP
EVPKTAVDHAKDYIQQLRSRTIIHTL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcactactgcgagagttgggtgcactgcggctacctaacctgaggatctgg
gcaacgcagacgctgcgggttttaccgccgtcgtgcatccacacgagtgcttctcttgac
atttctcgaaaatgggagaagaagaataaaattgtttacccacctcaactgcctggcgaa
cctcggagaccagcagaaatttaccattgtcggagacaaataaaatacagcaaggacaag
atgtggtacctggcaaagatgatacgaggcatgtccattgatcaggctttggcgcagctg
gaattcaatgataaaaagggggctcagatcattaaagaggttctcttagaagcacaagac
atggcagtgagagaccataatgtggagttcagatccaacttacacatagctgagtctacc
tcaggcagaggccagtgcctgaagcgcatccgttaccatggccgaggtcgctttggcatc
atggagaaggtctattgccactattttgtaaagctggtggaaggacccccacccccacct
gaagtacccaagacagcagttgaccacgccaaggactatattcagcagcttcgcagccgg
accatcatccatactctatga

DBGET integrated database retrieval system