KEGG   Mus caroli (Ryukyu mouse): 110305962Help
Entry
110305962         CDS       T05910                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00260  Glycine, serine and threonine metabolism
mcal01100  Metabolic pathways
mcal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110305962
Enzymes [BR:mcal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110305962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110305962
NCBI-ProteinID: XP_021033798
Ensembl: MGP_CAROLIEiJ_G0017475
Position
11
AA seq 391 aa AA seqDB search
MLRSLFRATVPGLRVPWAQWSRNWAGVPAHVVDLRSDTVTRPGPAMRRAMAEAVVGDDDY
GEDPTVHELQEKAAEMLGVERTMFVPTNTMANLISVMGHCRRRGSQVLLGQECHLHVYEQ
GGVAQIAGVHSHPLPDLPHGTLDLNELERALTRGSGSSYHPVCELVCLENTHSSAGGRVL
PVDYLRQVCLLAHAHGARVHMDGARLMNAAVALRMPPARLVEHCDSVSFCFSKGLGAPVG
ALVGGSKDFIGEAWRLRKALGGGMRQAGVLAAAALVGLAEAEEVLPRDHGNAQRFAKGLQ
DLASPICSVDPDTVETNMVLVQVAGLPPSDLCQRLQAVSAEEVAQTGRAVRVLLFPWTEQ
SVRAVWHRDVSAQDTELALRKWEFVLRQLRP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcagcctgttccgggccacggtcccagggctcagggtgccctgggctcagtgg
tctaggaattgggcgggggtcccagcccacgtggtggacctacgcagcgacacggtgacc
cggccagggccggccatgaggcgcgctatggctgaagcggttgtaggagacgatgattac
ggcgaagaccctacggtccacgaactgcaggaaaaggctgcagagatgcttggggtggag
aggacgatgtttgtgcccaccaacactatggccaacctcatctctgtgatgggtcactgc
cggcgccggggttcccaggtcctccttgggcaggaatgccacctccacgtctatgagcag
ggcggggtggcacagatcgctggggtgcattcccaccccctccccgacctgccccatggc
accttggacctgaatgagctagagagggcactcacccggggctctgggagttcctaccat
ccagtctgtgagctcgtgtgcctggagaacactcacagcagcgcgggaggccgggtcctc
ccggtcgactacctccgccaggtgtgcctcctggcccacgcccacggagcaagggtccac
atggatggagctcggttgatgaatgcagcagtggctctgcgcatgccccctgcccgcctt
gtagagcactgtgactctgtatccttctgtttctctaagggcctaggtgcaccagtggga
gctctggttgggggatccaaggacttcattggagaagcatggcgcctccgcaaggccctg
ggtggaggcatgcgccaggctggagtactggctgcggctgccctggtgggactagctgag
gcagaggaggtgctaccaagggaccacgggaatgcccagagattcgctaaaggactccaa
gacctggcgtcacccatttgctctgtggatcctgacaccgtggagaccaacatggtgctg
gtgcaggtggctgggctgcctccctcggatctgtgccagcgcctgcaggctgtgagtgca
gaggaggtggctcagactggccgtgccgtgcgcgtgctgctgtttccctggacagaacag
tctgtgcgggccgtgtggcaccgagatgtgtctgctcaggacacggaactggcgctgagg
aagtgggagtttgtgctgagacagttgcggccctga

DBGET integrated database retrieval system