KEGG   Mus caroli (Ryukyu mouse): 110306418
Entry
110306418         CDS       T05910                                 

Gene name
Akap5
Definition
(RefSeq) LOW QUALITY PROTEIN: A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110306418 (Akap5)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     110306418 (Akap5)
SSDB
Motif
Pfam: WSK RL10P_insert
Other DBs
NCBI-GeneID: 110306418
NCBI-ProteinID: XP_021034196
Position
12
AA seq 697 aa
MKECSIKMETSVSEIQVETKDEKGLIAASPQKERQERKTATLCFKRRKKSNKTKPKAGSR
TAEETKKHTPEAGGSGQRQPVGAWASIKRLVTHRKRSEPAKKQKPSEAEVQPEDGALPKK
KAKSRLKFPCLRFSRGAKRSRHSKLTEDSGYVRVQGEADDLEIKAQTQPDDQAIQARSTQ
GLQEGVLVRDGKKSQESHISNSVTSGENVIAIELELENESSAIQMGTPELEKETKVITEK
PSVQAQQASLLESSAASSPRSVTSAAPPSPATTHQHSLEEPSNGIRESTPSGKDDRRRKT
AAEENKSGETALGQAEEAAVGQADKRALSQAGEATAGHPEEATVIQAESQTKEGKLSQAE
ETTVAQAKETVLNQAKEGKLSQAEEPAVGQAKKATVGQAEEATIDHIEKVTVDQAEETTV
GQAEEATVGQAEEPTVGQVEEAILSQAKEATVXXXXEEAILSQAKEATVGQAEEATVGQA
EEPTVGQAEEATVGQAEEATVGQAEEATVGQAEEATVGHTEKVTVGQAEEATVGQAEEAT
VGQAEKVTVDQAEEATVGQAEEATVGQAEEPTVDQAEEAISSHAPDLKENGIDTEKPRSE
ESKRMEPIAIIITDTEISEFDVKKSKNVPKQFLISMENEQVGVFANDSDFEGRTSEQYET
LLIETASSLVKNAIELSVEQLVNEMVSEDNQINTLFQ
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgaaagagtgcagcatcaaaatggagaccagtgtttctgagattcaggtagagacgaag
gacgagaagggactaatagcagccagtcctcagaaagagaggcaggagagaaaaacagcc
acactctgcttcaagagaaggaagaaatcgaacaagacaaagcccaaagccggttccagg
actgctgaggagacaaagaaacatacccccgaagctgggggctctggtcaacggcaacca
gtgggtgcctgggcctccatcaaacgccttgtgacacacaggaaaaggtctgagcctgca
aagaagcaaaagccatctgaggcagaagtgcagcctgaggatggagctcttcctaagaaa
aaggcaaaatccagacttaagtttccttgcctaagattctcaagaggggcaaagagaagt
cgtcattccaaactcacagaagattcaggctacgtcagagtccagggagaggcagacgat
ttggagataaaagcccagacccagccagatgaccaggcaatccaggctaggtccacccag
ggcctacaggaaggtgtattggtgagagatggtaagaagagccaagaatcacacataagc
aacagcgtcacctcgggagagaatgtgatcgccatagaactggaattagaaaacgaatct
tctgctatccagatggggactccagagctggaaaaggagactaaggtgattacggaaaag
ccaagtgtgcaggcgcagcaagcaagtctacttgagagttcagcagcaagcagccctcgg
tcagtgacttctgctgctcctccatcaccagcaaccacacatcaacatagtctggaagaa
cccagtaatggcatccgggaaagtaccccaagtgggaaagatgacagaaggagaaagact
gctgctgaagaaaataaatcaggagaaactgcactgggacaggcagaggaagctgcagtt
ggccaggcagacaaaagggcactaagccaggcgggagaagctacagcgggccacccagag
gaagctactgtgatccaggcagagagtcagacaaaggaagggaaactgagccaggcagag
gaaactacagtggcccaggcaaaggaaactgtattgaatcaggcaaaggaaggtaaactg
agccaggcagaagaacctgcagttggccaggcaaagaaagctacagttggccaggcagag
gaagctacaattgaccacatagagaaagtcacagtggatcaggcagaggaaaccacagtg
ggtcaggcagaggaagctactgttggtcaggcagaggaacctactgttggtcaggtagag
gaagctatattgagccaagcaaaggaagctacagtnnnnnnnnnnnnagaggaagctata
ttgagccaagcaaaggaagctacagttggtcaggcagaggaagctactgttggtcaggca
gaggaacctactgttggtcaggcagaggaagctactgttggtcaggcagaggaagctact
gttggtcaggcagaggaagctactgttggtcaggcagaggaagctacagttggccacaca
gagaaagtcacagtgggtcaggcagaggaagccacagtgggtcaggcagaggaagctaca
gttggtcaggcagagaaagtcacagtggatcaggcagaggaagccacagtgggtcaggca
gaggaagccacagtgggtcaggcagaggaacccacagtggatcaggcagaggaagctata
tcaagccatgcaccagatctgaaagaaaatggaattgatacagagaaaccgagatcagaa
gaaagcaaaagaatggagccaattgctattatcattactgacactgaaatcagtgaattt
gatgttaagaaatctaaaaatgttcctaagcaattcctaatttcaatggaaaacgagcaa
gtgggggtttttgctaatgatagtgatttcgaggggagaacttcagaacagtatgaaaca
ctcttaatagaaacagcttcttctctcgtcaagaatgctatcgagttgtctgtggagcag
ctggttaacgaaatggtttccgaggataatcaaataaatacgctgttccagtga

DBGET integrated database retrieval system