KEGG   Mus caroli (Ryukyu mouse): 110306700Help
Entry
110306700         CDS       T05910                                 

Definition
(RefSeq) NEDD8-conjugating enzyme UBE2F-B-like isoform X1
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.23]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110306700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110306700
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     110306700
Ubiquitin system [BR:mcal04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   110306700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con
Motif
Other DBs
NCBI-GeneID: 110306700
NCBI-ProteinID: XP_021034402
Position
12
AA seq 164 aa AA seqDB search
MLTLASKLKQGEDLKGSQTSVSTSDSTRRFSVRGKLLVTEVAELEANLPCTYKVHFPDPN
KLHCFHLTVSPDEGYYQGGKFQFEIEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLL
REHSPDGTGWAPTRTLKDVVWGLNSLFTQHLRDKVAEYIKRYAR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgctggcaagcaagttgaagcagggtgaagatctcaaaggatcccagacatca
gtgtccacatctgactctactcggaggttttccgtgagaggtaagttgcttgttacagag
gttgcagaacttgaagctaatttaccttgtacctataaagtacattttcctgatccaaac
aagcttcattgctttcatctgactgtaagcccagatgagggttactaccagggtggaaaa
tttcagtttgaaattgaagttcctgatgcctacaatatggtgcctcccaaggtgaaatgc
ttgactaaaatctggcaccccaacatcacagaaacaggcgaaatatgtctaagtttacta
agagaacattcccctgatggcactggctgggcccccactcgaacattaaaggatgtcgtt
tggggattaaactctttatttacccaacatttgcgggacaaagtggctgagtacatcaaa
cgctatgccagatga

DBGET integrated database retrieval system